CX299949

Overview
NameCX299949
Unique NameCX299949
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length686
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig180 contig Ccv1_Contig180:188..873. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX299949 vs. ExPASy Swiss-Prot
Match: NDK1_ARATH (Nucleoside diphosphate kinase 1 OS=Arabidopsis thaliana GN=NDPK1 PE=1 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 3.583e-59
Identity = 105/133 (78.95%), Postives = 119/133 (89.47%), Query Frame = 2
Query:   17 GLVGEIIIRFEKKGFSLKGLKLMTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE 415
            GL+GE+I RFEKKGF+LKGLKL++V+R FAEKHYEDLSSK FF  L++YI SGPVVAMIWEG+ VV TGR IIGATNPA S PGTIRGD AI  GRN+IHGSDSVESA+KEIALWFPDGP+NWQSS+HPW+YE
Sbjct:   16 GLIGEVICRFEKKGFTLKGLKLISVERSFAEKHYEDLSSKSFFSGLVDYIVSGPVVAMIWEGKNVVLTGRKIIGATNPAASEPGTIRGDFAIDIGRNVIHGSDSVESARKEIALWFPDGPVNWQSSVHPWVYE 148          
BLAST of CX299949 vs. ExPASy Swiss-Prot
Match: NDKB_FLABI (Nucleoside diphosphate kinase B OS=Flaveria bidentis PE=2 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 1.362e-58
Identity = 107/133 (80.45%), Postives = 118/133 (88.72%), Query Frame = 2
Query:   17 GLVGEIIIRFEKKGFSLKGLKLMTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE 415
            GLVGEII RFEKKGFSLKGLKL+TVD+ FAEKHY DLS+KPFF  L+EYI SGPVVAM+WEG+ VV TGR IIGATNPA+SAPGTIRGD AI  GRN+IHGSD+VESA+KEIALWFP+G  NW SSLHPWIYE
Sbjct:   16 GLVGEIIGRFEKKGFSLKGLKLLTVDQAFAEKHYADLSAKPFFNGLVEYIISGPVVAMVWEGKNVVTTGRKIIGATNPAESAPGTIRGDFAIDIGRNVIHGSDAVESAKKEIALWFPEGVANWSSSLHPWIYE 148          
BLAST of CX299949 vs. ExPASy Swiss-Prot
Match: NDKA_FLABI (Nucleoside diphosphate kinase A OS=Flaveria bidentis PE=2 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 1.778e-58
Identity = 107/135 (79.26%), Postives = 117/135 (86.67%), Query Frame = 2
Query:   11 EGGLVGEIIIRFEKKGFSLKGLKLMTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE 415
            + GLVGEII RFEKKGFSLKGLKL+TVDR FAEKHY DLSSKPFF  L+EYI SGPVVAM+WEG+ VV TGR IIGATNPA+SAPGTIRGD AI  GRN+IHGSD+VESA+K I LWFP+G  NW SSLHPWIYE
Sbjct:   14 QSGLVGEIIGRFEKKGFSLKGLKLLTVDRAFAEKHYADLSSKPFFNGLVEYIVSGPVVAMVWEGKNVVTTGREIIGATNPAESAPGTIRGDFAIDIGRNVIHGSDAVESARKVIGLWFPEGVANWSSSLHPWIYE 148          
BLAST of CX299949 vs. ExPASy Swiss-Prot
Match: NDK1_TOBAC (Nucleoside diphosphate kinase 1 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 1.153e-57
Identity = 106/133 (79.70%), Postives = 117/133 (87.97%), Query Frame = 2
Query:   17 GLVGEIIIRFEKKGFSLKGLKLMTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE 415
            GLVGEII RFEKKGFSLKGLKL+TVDR FAEKHY DLS+KPFF  L++YI SGPVVAM+WEG+GVV TGR IIGATNP +SAPGTIRGD AI  GRN+IHGSD+VESA+KEIALWFP+G   WQSSLH WIYE
Sbjct:   16 GLVGEIIGRFEKKGFSLKGLKLITVDRAFAEKHYSDLSAKPFFNGLVDYIISGPVVAMVWEGKGVVTTGRKIIGATNPLESAPGTIRGDYAIDIGRNVIHGSDAVESARKEIALWFPEGVAEWQSSLHSWIYE 148          
BLAST of CX299949 vs. ExPASy Swiss-Prot
Match: NDK1_MESCR (Nucleoside diphosphate kinase 1 OS=Mesembryanthemum crystallinum GN=NDKP1 PE=2 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 1.966e-57
Identity = 105/133 (78.95%), Postives = 114/133 (85.71%), Query Frame = 2
Query:   17 GLVGEIIIRFEKKGFSLKGLKLMTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE 415
            GLVGEII RFEKKGFSLK LK + VDRPFAEKHY DLS+KPFF  L+EYI SGPVVAM+WEG+GVV TGR IIGATNP  S PGTIRGD AI  GRN+IHGSD+VESA KEIALWFP+G +NWQSSLH WIYE
Sbjct:   16 GLVGEIISRFEKKGFSLKALKFINVDRPFAEKHYADLSAKPFFNGLVEYIVSGPVVAMVWEGKGVVLTGRKIIGATNPLASEPGTIRGDFAIDIGRNVIHGSDAVESATKEIALWFPEGVVNWQSSLHSWIYE 148          
BLAST of CX299949 vs. ExPASy Swiss-Prot
Match: NDK_HELAN (Nucleoside diphosphate kinase OS=Helianthus annuus PE=2 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 3.354e-57
Identity = 104/133 (78.20%), Postives = 116/133 (87.22%), Query Frame = 2
Query:   17 GLVGEIIIRFEKKGFSLKGLKLMTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE 415
            GLVGEII RFEKKGF+LKGLKL+TVD+ FAEKHY DLS+KPFF  L+EYI SGPVVAM+WEG+ VV TGR IIGATNPA+S PGTIRGD AI  GRN+IHGSD+VESA+KEI LWFP+G  NW SSLHPWIYE
Sbjct:   16 GLVGEIIGRFEKKGFTLKGLKLLTVDQAFAEKHYADLSAKPFFNGLVEYIISGPVVAMVWEGKNVVTTGRKIIGATNPAESPPGTIRGDFAIDIGRNVIHGSDAVESAKKEIGLWFPEGVANWSSSLHPWIYE 148          
BLAST of CX299949 vs. ExPASy Swiss-Prot
Match: NDK1_SOYBN (Nucleoside diphosphate kinase 1 OS=Glycine max PE=2 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 3.354e-57
Identity = 106/133 (79.70%), Postives = 115/133 (86.47%), Query Frame = 2
Query:   17 GLVGEIIIRFEKKGFSLKGLKLMTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE 415
            GL+GEII RFEKKGF LKGLKL+TVDRPFAEKHY DLS+KPFF  L++YI SGPVVAMIWEG+ VV TGR IIGATNPAQS PGTIRGD AI  GRN+IHGSD+VESA KEIALWFP+GP N QSS H WIYE
Sbjct:   17 GLIGEIISRFEKKGFYLKGLKLVTVDRPFAEKHYADLSAKPFFSGLVDYIISGPVVAMIWEGKNVVTTGRKIIGATNPAQSEPGTIRGDFAIDIGRNVIHGSDAVESANKEIALWFPEGPANCQSSQHSWIYE 149          
BLAST of CX299949 vs. ExPASy Swiss-Prot
Match: NDK_CAPAN (Nucleoside diphosphate kinase OS=Capsicum annuum PE=2 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 4.380e-57
Identity = 105/133 (78.95%), Postives = 117/133 (87.97%), Query Frame = 2
Query:   17 GLVGEIIIRFEKKGFSLKGLKLMTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE 415
            GLVGEII RFEKKGFSLKGLKL+TVDR FAEKHY DLS+KPFF  L+EYI SGPVV+M+WEG+GV+ TGR IIGATNP +SAPGTIRGD AI  GRN+IHGSD+VESA+KEIALWFP+G   WQSSLH WIYE
Sbjct:   16 GLVGEIIGRFEKKGFSLKGLKLITVDRAFAEKHYADLSAKPFFNGLVEYIVSGPVVSMVWEGKGVLTTGRKIIGATNPLESAPGTIRGDYAIDIGRNVIHGSDAVESARKEIALWFPEGVAEWQSSLHCWIYE 148          
BLAST of CX299949 vs. ExPASy Swiss-Prot
Match: NDK1_SPIOL (Nucleoside diphosphate kinase 1 OS=Spinacia oleracea GN=NDPK1 PE=2 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 7.471e-57
Identity = 103/133 (77.44%), Postives = 114/133 (85.71%), Query Frame = 2
Query:   17 GLVGEIIIRFEKKGFSLKGLKLMTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE 415
            GLVGEII RFEKKGFSLK LK + VDRPFAEKHY DLS+KPFF  L+EYI SGPVVAM+WEG+GVV TGR +IGATNP  S PGTIRGD AI  GRN+IHGSD+V+SA KEIALWFPDG ++WQSSLH WIYE
Sbjct:   16 GLVGEIISRFEKKGFSLKALKFVNVDRPFAEKHYADLSAKPFFNGLVEYIVSGPVVAMVWEGKGVVATGRKLIGATNPLASEPGTIRGDFAIDIGRNVIHGSDAVDSATKEIALWFPDGVVHWQSSLHSWIYE 148          
BLAST of CX299949 vs. ExPASy Swiss-Prot
Match: NDK_SOLLC (Nucleoside diphosphate kinase (Fragment) OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 8.261e-56
Identity = 105/133 (78.95%), Postives = 115/133 (86.47%), Query Frame = 2
Query:   17 GLVGEIIIRFEKKGFSLKGLKLMTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE 415
            GLVGEII RFEKKGFSLKGLKL+TVDR FAEKHY DLS+KPFF  L+EYI SGPVVAM+WEG+GVV TGR IIGATNP +SA GTIRGD AI  GRN+IHGSD+VESA+KEIALWFP+G   WQSSLH  IYE
Sbjct:   12 GLVGEIISRFEKKGFSLKGLKLITVDRAFAEKHYADLSAKPFFNGLVEYIVSGPVVAMVWEGKGVVATGRKIIGATNPLESAAGTIRGDFAIDIGRNVIHGSDAVESARKEIALWFPEGIAEWQSSLHSCIYE 144          
The following BLAST results are available for this feature:
BLAST of CX299949 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
NDK1_ARATH3.583e-5978.95Nucleoside diphosphate kinase 1 OS=Arabidopsis tha... [more]
NDKB_FLABI1.362e-5880.45Nucleoside diphosphate kinase B OS=Flaveria bident... [more]
NDKA_FLABI1.778e-5879.26Nucleoside diphosphate kinase A OS=Flaveria bident... [more]
NDK1_TOBAC1.153e-5779.70Nucleoside diphosphate kinase 1 OS=Nicotiana tabac... [more]
NDK1_MESCR1.966e-5778.95Nucleoside diphosphate kinase 1 OS=Mesembryanthemu... [more]
NDK_HELAN3.354e-5778.20Nucleoside diphosphate kinase OS=Helianthus annuus... [more]
NDK1_SOYBN3.354e-5779.70Nucleoside diphosphate kinase 1 OS=Glycine max PE=... [more]
NDK_CAPAN4.380e-5778.95Nucleoside diphosphate kinase OS=Capsicum annuum P... [more]
NDK1_SPIOL7.471e-5777.44Nucleoside diphosphate kinase 1 OS=Spinacia olerac... [more]
NDK_SOLLC8.261e-5678.95Nucleoside diphosphate kinase (Fragment) OS=Solanu... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07004D02SK SaltLeaf1 Citrus clementina cDNA clone C07004D02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX299949 ID=CX299949|Name=CX299949|organism=Citrus clementina|type=EST|length=686bp
AATTCGGCACGAGGGAGGCCTTGTTGGTGAAATCATCATCAGATTTGAGA
AGAAGGGTTTCTCCTTGAAGGGTTTGAAGCTTATGACTGTGGACCGCCCT
TTTGCTGAGAAGCACTATGAGGATTTGTCATCGAAGCCTTTCTTTGGTTC
TCTGATTGAGTACATTACCTCTGGTCCTGTTGTTGCTATGATTTGGGAGG
GTGAAGGTGTTGTTAAGACTGGCCGCACTATTATTGGAGCCACCAACCCT
GCGCAGTCTGCTCCTGGAACCATCCGTGGTGATTTGGCTATCGTGACGGG
CAGGAATATCATCCATGGAAGTGACTCAGTTGAGAGTGCCCAGAAAGAAA
TCGCCTTGTGGTTCCCTGATGGCCCTATTAACTGGCAGAGCAGCCTTCAC
CCTTGGATCTATGAGTAAACTAATGTTTGGTTGAGGAGCCTAATTGTTCC
TGCAGTTAGACTTATCCCTATCCCTATCCCTATTTCCTTATTTATGGTTA
CTCCTTGTTGGTGAACTGTTATGAAGTATTGAGTTAAATTGAGACCAATC
CTGGTTATGTTGGCTGCTTTCATTCTTGTGGTTGCCATATACAATATTTA
AGCTTTTTTGTTGACTGTATTATGAATTGAGTTTGTTAATGGTTAGCACA
TGATGGTTGCACTTTTTAAAAAAAAAAAAAAAAAAA
back to top