CX299958

Overview
NameCX299958
Unique NameCX299958
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length540
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX299958 vs. ExPASy Swiss-Prot
Match: CHI4_ORYSJ (Chitinase 4 OS=Oryza sativa subsp. japonica GN=Cht4 PE=2 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 1.291e-19
Identity = 54/115 (46.96%), Postives = 68/115 (59.13%), Query Frame = -3
Query:  215 GKFYYGRGPIQLTGNGNYIDAGRAIGFDGLNSPETVARDRVISFKTALWYWMRYVHSALNQGLGETIRKIKNHPNRATQQRKGVGKTPAPRDKK*N-------TWGNNPRPNLEC 538
            GK YYGRGP+Q++ N NY  AG+ IGFDGL  P+ VA+D  ISFKTALW+WM  VH  ++QG G TIR I    N A +     GK P   + + N        +G +P  NL C
Sbjct:  178 GKKYYGRGPLQISWNFNYGPAGKNIGFDGLRDPDKVAQDPTISFKTALWFWMNNVHQVMSQGFGATIRAI----NGALECN---GKNPGAVNARVNYYKDYCRQFGVSPGGNLYC 285          
BLAST of CX299958 vs. ExPASy Swiss-Prot
Match: CHI5_ORYSJ (Chitinase 5 OS=Oryza sativa subsp. japonica GN=Cht5 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 4.906e-19
Identity = 54/115 (46.96%), Postives = 67/115 (58.26%), Query Frame = -3
Query:  215 GKFYYGRGPIQLTGNGNYIDAGRAIGFDGLNSPETVARDRVISFKTALWYWMRYVHSALNQGLGETIRKIKNHPNRATQQRKGVGKTPAPRDKK*N-------TWGNNPRPNLEC 538
            GK YYGRGP+Q++ N NY  AG+ IGFDGL  P+ VA+D  ISFKTALW+WM  VH  + QG G TIR I    N A +     GK P   + + N        +G +P  NL C
Sbjct:  181 GKKYYGRGPLQISWNYNYGPAGQNIGFDGLRDPDRVAQDPTISFKTALWFWMNNVHQVMLQGFGATIRAI----NGALECN---GKNPGAVNARVNYYKDYCRQFGVDPGGNLYC 288          
BLAST of CX299958 vs. ExPASy Swiss-Prot
Match: CHI4_PHAVU (Endochitinase PR4 OS=Phaseolus vulgaris GN=CHI4 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 4.906e-19
Identity = 44/69 (63.77%), Postives = 52/69 (75.36%), Query Frame = -3
Query:  329 KFYYGRGPIQLTGNGNYIDAGRAIGFDGLNSPETVARDRVISFKTALWYWMRYVHSALNQGLGETIRKI 535
            K Y+GRGPIQL+ N NY  AG A  FDGL +PETV+ D V+SFKTALWYWM++V   +NQG G TIR I
Sbjct:  164 KGYHGRGPIQLSWNFNYGPAGSANNFDGLGAPETVSNDVVVSFKTALWYWMQHVRPVINQGFGATIRAI 232          
BLAST of CX299958 vs. ExPASy Swiss-Prot
Match: CHIB_MAIZE (Endochitinase B (Fragment) OS=Zea mays PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 6.408e-19
Identity = 52/115 (45.22%), Postives = 67/115 (58.26%), Query Frame = -3
Query:  215 GKFYYGRGPIQLTGNGNYIDAGRAIGFDGLNSPETVARDRVISFKTALWYWMRYVHSALNQGLGETIRKIKNHPNRATQQRKGVGKTPAPRDKK*NTW-------GNNPRPNLEC 538
            G+ YYGRGP+Q++ N NY  AGRAIGFDGL  P  VARD V++FK ALW+WM  VH  + QG G T R ++    RA +     G  PA  + +   +       G +P PNL C
Sbjct:  162 GQKYYGRGPLQISWNYNYGPAGRAIGFDGLGDPGRVARDAVVAFKAALWFWMNSVHGVVPQGFGATTRAMQ----RALECG---GNNPAQMNARVGYYRQYCRQLGVDPGPNLTC 269          
BLAST of CX299958 vs. ExPASy Swiss-Prot
Match: CHIP_BETVU (Acidic endochitinase SP2 OS=Beta vulgaris GN=SP2 PE=1 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.093e-18
Identity = 43/70 (61.43%), Postives = 51/70 (72.86%), Query Frame = -3
Query:  329 GKFYYGRGPIQLTGNGNYIDAGRAIGFDGLNSPETVARDRVISFKTALWYWMRYVHSALNQGLGETIRKI 538
            GK YYGRGP+QL+ N NY  AG+AIGFDGL +PE VA D   SFK A+W+WM  VHS +NQG G T + I
Sbjct:  181 GKKYYGRGPLQLSWNYNYALAGQAIGFDGLGNPEKVATDVNTSFKAAMWFWMTNVHSVMNQGFGATTKAI 250          
BLAST of CX299958 vs. ExPASy Swiss-Prot
Match: CHIA_MAIZE (Endochitinase A OS=Zea mays PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 2.435e-18
Identity = 46/89 (51.69%), Postives = 56/89 (62.92%), Query Frame = -3
Query:  284 GKFYYGRGPIQLTGNGNYIDAGRAIGFDGLNSPETVARDRVISFKTALWYWMRYVHSALNQGLGETIRKIKN----HPNRATQQRKGVG 538
            G+ YYGRGP+Q++ N NY  AGR IGF+GL  P  VA+D VI+FKTALW+WM  VH  + QG G TIR I      + N   Q    VG
Sbjct:  173 GQKYYGRGPLQISWNYNYGPAGRDIGFNGLADPNRVAQDAVIAFKTALWFWMNNVHGVMPQGFGATIRAINGALECNGNNPAQMNARVG 261          
BLAST of CX299958 vs. ExPASy Swiss-Prot
Match: CHI6_ORYSJ (Chitinase 6 OS=Oryza sativa subsp. japonica GN=Cht6 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 4.153e-18
Identity = 49/110 (44.55%), Postives = 62/110 (56.36%), Query Frame = -3
Query:  215 GKFYYGRGPIQLTGNGNYIDAGRAIGFDGLNSPETVARDRVISFKTALWYWMRYVHSAL--NQGLGETIRKIKNHPNRATQQRKGVGKTPAPRDKK*NTWGNNPRPNLEC 538
            GK YYGRGP+Q++ N NY  AG++IGFDGL  P+ VAR  V++F+TALWYW   VH A    QG G TIR I        +    V    A   +    +G +P  NL C
Sbjct:  162 GKGYYGRGPLQISWNFNYGPAGQSIGFDGLGDPDAVARSPVLAFQTALWYWTNNVHDAFVSGQGFGATIRAINGALECDGKNPTAVSNRVAYYQQFCQQFGVDPGSNLTC 271          
BLAST of CX299958 vs. ExPASy Swiss-Prot
Match: CHIT_DIOJA (Acidic endochitinase OS=Dioscorea japonica PE=1 SV=2)

HSP 1 Score: 88.1965 bits (217), Expect = 2.692e-17
Identity = 43/73 (58.90%), Postives = 53/73 (72.60%), Query Frame = -3
Query:  329 KFYYGRGPIQLTGNGNYIDAGRAIGFDGLNSPETVARDRVISFKTALWYWMR----YVHSALNQGLGETIRKI 535
            K Y+GRGP+QL+ N NYIDAG+ + FDGLN P+ V RD +ISFKT+LW+W+R    YV    NQG G TIR I
Sbjct:  140 KEYFGRGPMQLSWNYNYIDAGKELHFDGLNDPDIVGRDPIISFKTSLWFWIRKGVQYVILDPNQGFGATIRII 212          
BLAST of CX299958 vs. ExPASy Swiss-Prot
Match: CHI2_PEA (Endochitinase A2 OS=Pisum sativum GN=CHI2 PE=1 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 3.639e-14
Identity = 36/52 (69.23%), Postives = 41/52 (78.85%), Query Frame = -3
Query:  383 GKFYYGRGPIQLTGNGNYIDAGRAIGFDGLNSPETVARDRVISFKTALWYWM 538
            GK YYGRGPIQ++ N NY   GRAIG D LN+P+ VA D VISFKTALW+WM
Sbjct:  173 GKQYYGRGPIQISWNYNYGQCGRAIGVDLLNNPDLVATDPVISFKTALWFWM 224          
BLAST of CX299958 vs. ExPASy Swiss-Prot
Match: CHI4_BRANA (Basic endochitinase CHB4 OS=Brassica napus PE=1 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 8.106e-14
Identity = 42/108 (38.89%), Postives = 56/108 (51.85%), Query Frame = -3
Query:  215 GKFYYGRGPIQLTGNGNYIDAGRAIGFDGLNSPETVARDRVISFKTALWYWMRYVHSALNQGLGETIRKIKNHPNRATQQRKGVGKTPAPRDKK*NTWGNNPRPNLEC 538
            GK Y+GRGPIQL+ N NY   G+++  + L  PE V+ +  ++F+T LW+WM  V   LNQG G TIR I               +    RD      G +P PNL C
Sbjct:  162 GKGYFGRGPIQLSWNYNYGACGQSLNLNLLGQPELVSSNPTVAFRTGLWFWMNSVRPVLNQGFGATIRAINGMECNGGNSGAVNARIRYYRDYC-GQLGVDPGPNLSC 268          
The following BLAST results are available for this feature:
BLAST of CX299958 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 46
Match NameE-valueIdentityDescription
CHI4_ORYSJ1.291e-1946.96Chitinase 4 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHI5_ORYSJ4.906e-1946.96Chitinase 5 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHI4_PHAVU4.906e-1963.77Endochitinase PR4 OS=Phaseolus vulgaris GN=CHI4 PE... [more]
CHIB_MAIZE6.408e-1945.22Endochitinase B (Fragment) OS=Zea mays PE=1 SV=1[more]
CHIP_BETVU1.093e-1861.43Acidic endochitinase SP2 OS=Beta vulgaris GN=SP2 P... [more]
CHIA_MAIZE2.435e-1851.69Endochitinase A OS=Zea mays PE=1 SV=1[more]
CHI6_ORYSJ4.153e-1844.55Chitinase 6 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHIT_DIOJA2.692e-1758.90Acidic endochitinase OS=Dioscorea japonica PE=1 SV... [more]
CHI2_PEA3.639e-1469.23Endochitinase A2 OS=Pisum sativum GN=CHI2 PE=1 SV=... [more]
CHI4_BRANA8.106e-1438.89Basic endochitinase CHB4 OS=Brassica napus PE=1 SV... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07004D11SK SaltLeaf1 Citrus clementina cDNA clone C07004D11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX299958 ID=CX299958|Name=CX299958|organism=Citrus clementina|type=EST|length=540bp
AGAGAGAACTAGTCTCGAGTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT
TTACTGCAAATCATCCATTAATTTTCTCTTTATTTTATGATCAGGTACAC
AAAAATTATTCCATCAGAGTTACCAAACAAAGAAAGTTGTTTGGAATAAC
TCTGGCTTACTGGGATATAATATAATACACATAGTGTAACATTTTCATAC
CAAATATCTAATCAGCACTCGAGATTTGGTCTGGGATTGTTACCCCATGT
GTTTTATTTTTTATCGCGGGGGGCCGGGGTTTTTCCAACCCCCTTTCTTT
GTTGGGTCGCCCGGTTGGGATGATTTTTGATTTTCCGAATTGTTTCACCG
AGACCTTGGTTTAGTGCTGAGTGCACGTATCTCATCCAATACCACAAAGC
AGTCTTGAAAGATATGACACGGTCCCTGGCCACCGTTTCCGGAGAGTTCA
GACCGTCGAAACCGATGGCCCTTCCGGCATCTATGTAGTTTCCGTTTCCG
GTGAGCTGAATCGGTCCCCGGCCATAGTAGAATTTACCAT
back to top