CX299963

Overview
NameCX299963
Unique NameCX299963
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length493
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13620 contig Ccv1_Contig13620:1168..1660. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX299963 vs. ExPASy Swiss-Prot
Match: P2C59_ARATH (Probable protein phosphatase 2C 59 OS=Arabidopsis thaliana GN=WIN2 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.806e-11
Identity = 32/40 (80.00%), Postives = 35/40 (87.50%), Query Frame = 2
Query:    2 IKPIQDPEEAAKRLMQEAYQRGSADNITCVVVRFLANQGG 121
            IK I+DPEE AKRLM EAYQRGSADNITCVVVRF ++Q G
Sbjct:  246 IKAIEDPEEGAKRLMMEAYQRGSADNITCVVVRFFSDQAG 285          
The following BLAST results are available for this feature:
BLAST of CX299963 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
P2C59_ARATH1.806e-1180.00Probable protein phosphatase 2C 59 OS=Arabidopsis ... [more]
back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07004E05SK SaltLeaf1 Citrus clementina cDNA clone C07004E05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX299963 ID=CX299963|Name=CX299963|organism=Citrus clementina|type=EST|length=493bp
GATCAAACCAATCCAGGATCCAGAGGAGGCAGCGAAGAGGCTGATGCAGG
AGGCATATCAGAGAGGCAGCGCAGACAACATCACCTGTGTCGTTGTTCGG
TTCTTGGCCAATCAAGGTGGTTCATCCTTTCCTGGCTCTGCATGAACATC
CTTTCATAGCCACCGCTCTGCTTTTGTTCTCTACATGGGCATCCTTTCAG
TGGTCTACAGCTAGTAGTCATAGAAAAATTACAGTTTCGTTGTACTTTGT
AATGATAGAACATGAACAAAAAGCTTACCCCGGCCGTTAATGTGTATTAC
GTATTATCAGTCTCTGGAATAGATGTGTCCGAAGTTTAACATCTGTTCTC
GGTCCTCGAAATGTAGCTAGAAATGTGTATGTATGCATGTGTAAAGAATT
GGCAAAGACTTCTAAAGTTTCAATTTCCTATGTTGTAAATGTAGATGAAA
CTCTTCTGTTGCTCATAGTTTAAAAAAAAAAAAAAAAAAAAAA
back to top