CX300193

Overview
NameCX300193
Unique NameCX300193
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length430
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig5796 contig Ccv1_Contig5796:966..1395. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX300193 vs. ExPASy Swiss-Prot
Match: G3PA_SPIOL (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Spinacia oleracea GN=GAPA PE=1 SV=2)

HSP 1 Score: 177.178 bits (448), Expect = 2.477e-44
Identity = 89/117 (76.07%), Postives = 91/117 (77.78%), Query Frame = 2
Query:    2 VLPALKGKLNGIALRVPTPNXXXXXXXXXXSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCXXXXXXXXXXXXXXMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK 352
            VLP LKGKLNGIALRVPTPN          SKKTFAEEVNAAFRESADNELKGILSVCDEPLVS+DFRC              MGDDMVKVIAWYDNEWGYSQRVVDLADIVAN W+
Sbjct:  285 VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQ 401          
BLAST of CX300193 vs. ExPASy Swiss-Prot
Match: G3PA_ARATH (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Arabidopsis thaliana GN=GAPA PE=1 SV=3)

HSP 1 Score: 174.866 bits (442), Expect = 1.229e-43
Identity = 88/117 (75.21%), Postives = 90/117 (76.92%), Query Frame = 2
Query:    2 VLPALKGKLNGIALRVPTPNXXXXXXXXXXSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCXXXXXXXXXXXXXXMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK 352
            VLP LKGKLNGIALRVPTPN          SKKTFAEEVNAAFR+SA+ ELKGIL VCDEPLVSVDFRC              MGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK
Sbjct:  280 VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK 396          
BLAST of CX300193 vs. ExPASy Swiss-Prot
Match: G3PA_SINAL (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic (Fragment) OS=Sinapis alba GN=GAPA PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 2.739e-43
Identity = 87/117 (74.36%), Postives = 90/117 (76.92%), Query Frame = 2
Query:    2 VLPALKGKLNGIALRVPTPNXXXXXXXXXXSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCXXXXXXXXXXXXXXMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK 352
            VLP LKGKLNGIALRVPTPN          SKKTFAEEVNAAFR++A+ ELKGIL VCDEPLVSVDFRC              MGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK
Sbjct:  117 VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK 233          
BLAST of CX300193 vs. ExPASy Swiss-Prot
Match: G3PA_PEA (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Pisum sativum GN=GAPA PE=2 SV=2)

HSP 1 Score: 171.4 bits (433), Expect = 1.359e-42
Identity = 87/117 (74.36%), Postives = 88/117 (75.21%), Query Frame = 2
Query:    2 VLPALKGKLNGIALRVPTPNXXXXXXXXXXSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCXXXXXXXXXXXXXXMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK 352
            VLP LKGKLNGIALRVPTPN          SKKTFAEEVN AFRESA  EL GILSVCDEPLVSVDFRC              MGDD+VKVIAWYDNEWGYSQRVVDLADIVANNWK
Sbjct:  289 VLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNEAFRESAAKELTGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNWK 405          
BLAST of CX300193 vs. ExPASy Swiss-Prot
Match: G3PA_MAIZE (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Zea mays GN=GAPA PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 4.092e-39
Identity = 81/117 (69.23%), Postives = 84/117 (71.79%), Query Frame = 2
Query:    2 VLPALKGKLNGIALRVPTPNXXXXXXXXXXSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCXXXXXXXXXXXXXXMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK 352
            VLP LKGKLNGIALRVPTPN          SKKT AEEVN AFR++A NEL GIL VCD PLVSVDFRC              MGDDMVKVI+WYDNEWGYSQRVVDLADI AN WK
Sbjct:  287 VLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELTGILEVCDVPLVSVDFRCSDVSSTIDASLTMVMGDDMVKVISWYDNEWGYSQRVVDLADICANQWK 403          
BLAST of CX300193 vs. ExPASy Swiss-Prot
Match: G3PA_TOBAC (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GAPA PE=2 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 2.653e-38
Identity = 79/114 (69.30%), Postives = 82/114 (71.93%), Query Frame = 2
Query:   11 ALKGKLNGIALRVPTPNXXXXXXXXXXSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCXXXXXXXXXXXXXXMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK 352
            AL+G    + LRVPTPN          SKKTFAEEVNAAFRE+AD ELKGIL VCDEPLVSVDFRC              MGDDMVKVIAWYDNEWGYSQRVVDLADIVAN WK
Sbjct:  279 ALRGSSMALPLRVPTPNVSVVDLVVQVSKKTFAEEVNAAFREAADKELKGILDVCDEPLVSVDFRCSDVSSTVDASLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANQWK 392          
BLAST of CX300193 vs. ExPASy Swiss-Prot
Match: G3PB_TOBAC (Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GAPB PE=2 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 1.008e-37
Identity = 78/117 (66.67%), Postives = 86/117 (73.50%), Query Frame = 2
Query:    2 VLPALKGKLNGIALRVPTPNXXXXXXXXXXSKKTF-AEEVNAAFRESADNELKGILSVCDEPLVSVDFRCXXXXXXXXXXXXXXMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW 349
            VLP LKGKLNGIALRVPTPN          +KK   AE+VNAAFR++AD  LKG+L+VCDEPLVSVDFRC              MGDDMVKV+AWYDNEWGYSQRVVDLA +VANNW
Sbjct:  275 VLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGITAEDVNAAFRKAADGPLKGVLAVCDEPLVSVDFRCSDVSSTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANNW 391          
BLAST of CX300193 vs. ExPASy Swiss-Prot
Match: G3PB_PEA (Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Pisum sativum GN=GAPB PE=2 SV=2)

HSP 1 Score: 148.673 bits (374), Expect = 9.435e-36
Identity = 76/117 (64.96%), Postives = 83/117 (70.94%), Query Frame = 2
Query:    2 VLPALKGKLNGIALRVPTPNXXXXXXXXXXSKKTF-AEEVNAAFRESADNELKGILSVCDEPLVSVDFRCXXXXXXXXXXXXXXMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW 349
            VLP LKGKLNGIALRVPTPN          +KK   AE+VNAAFR++A+  LKGIL VCD PLVSVDFRC              MGDDMVKV+AWYDNEWGYSQRVVDLA +VAN W
Sbjct:  306 VLPQLKGKLNGIALRVPTPNVSVVDLVVNVAKKGISAEDVNAAFRKAAEGPLKGILDVCDVPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVANKW 422          
BLAST of CX300193 vs. ExPASy Swiss-Prot
Match: G3PA_CHLRE (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Chlamydomonas reinhardtii GN=GAPA PE=1 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 9.435e-36
Identity = 72/116 (62.07%), Postives = 82/116 (70.69%), Query Frame = 2
Query:    2 VLPALKGKLNGIALRVPTPNXXXXXXXXXXSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSVDFRCXXXXXXXXXXXXXXMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW 349
            VLP+LKGKLNGIALRVPTP            KKTFAEEVNAAFRE+A+  +KG+L V D PLVS+DF+C              MGDDMVKV+AWYDNEWGYSQRVVDLA++ A  W
Sbjct:  257 VLPSLKGKLNGIALRVPTPTVSVVDLVVQVEKKTFAEEVNAAFREAANGPMKGVLHVEDAPLVSIDFKCTDQSTSIDASLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAEVTAKKW 372          
BLAST of CX300193 vs. ExPASy Swiss-Prot
Match: G3PB_ARATH (Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Arabidopsis thaliana GN=GAPB PE=1 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 3.035e-34
Identity = 73/117 (62.39%), Postives = 81/117 (69.23%), Query Frame = 2
Query:    2 VLPALKGKLNGIALRVPTPNXXXXXXXXXXSKKTF-AEEVNAAFRESADNELKGILSVCDEPLVSVDFRCXXXXXXXXXXXXXXMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNW 349
            VLP LKGKLNGIALRVPTPN           KK   AE+VN AFR++A+  +KGIL VCD PLVSVDFRC              MGDDMVKV+AWYDNEWGYSQRVVDLA +VA+ W
Sbjct:  302 VLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAEDVNEAFRKAANGPMKGILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQRVVDLAHLVASKW 418          
The following BLAST results are available for this feature:
BLAST of CX300193 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 240
Match NameE-valueIdentityDescription
G3PA_SPIOL2.477e-4476.07Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PA_ARATH1.229e-4375.21Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PA_SINAL2.739e-4374.36Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PA_PEA1.359e-4274.36Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PA_MAIZE4.092e-3969.23Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PA_TOBAC2.653e-3869.30Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PB_TOBAC1.008e-3766.67Glyceraldehyde-3-phosphate dehydrogenase B, chloro... [more]
G3PB_PEA9.435e-3664.96Glyceraldehyde-3-phosphate dehydrogenase B, chloro... [more]
G3PA_CHLRE9.435e-3662.07Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PB_ARATH3.035e-3462.39Glyceraldehyde-3-phosphate dehydrogenase B, chloro... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07007C09SK SaltLeaf1 Citrus clementina cDNA clone C07007C09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX300193 ID=CX300193|Name=CX300193|organism=Citrus clementina|type=EST|length=430bp
TGTCCTCCCAGCACTCAAAGGCAAACTAAACGGCATTGCCCTTCGTGTGC
CAACACCAAACGTCTCGGTTGTTGATCTTGTCGTTCAGGTGTCGAAGAAA
ACCTTCGCAGAAGAGGTGAACGCCGCTTTCAGAGAAAGCGCTGACAATGA
ACTGAAAGGGATCCTCTCCGTGTGCGACGAGCCCCTCGTTTCGGTCGACT
TCAGGTGCTCTGATGTATCCTCAACCGTTGATTCATCTCTCACACTTGTC
ATGGGAGACGACATGGTTAAGGTGATTGCATGGTATGACAATGAATGGGG
TTACTCTCAAAGGGTTGTGGATTTGGCCGACATTGTTGCCAACAACTGGA
AGTGAAGTAAATACTAAAATCGGAACTCGGCTGTAATCGGCACAACGATG
TTCTTGTTTTTCATTTTTGGTTCCCCCATT
back to top