CX300194

Overview
NameCX300194
Unique NameCX300194
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length377
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13924 contig Ccv1_Contig13924:432..808. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX300194 vs. ExPASy Swiss-Prot
Match: SPE1_SOLLC (Arginine decarboxylase OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 2.583e-51
Identity = 92/125 (73.60%), Postives = 108/125 (86.40%), Query Frame = 3
Query:    3 ADQLKQRCIEQFKDGTLGIEQLATVDGLCDFVAKEIGASDPVRTYHVNLSIFTSIPDYWAIGQLFPIVPIHHLDERPGVRGVLSDLTCDSDGKIDKFIGGGTSLPLHEMVGGGCGERGPYYLGMF 377
            +DQLKQRC+EQFKDG+L IEQLA VD +CD+V+K IG +DPVRTYHVNLS+FTSIPD+W   QLFPIVPIH LDE+P +RG+LSDLTCDSDGK+DKFIGG +SLPLHE+   G G+ G YYLGMF
Sbjct:  347 SDQLKQRCVEQFKDGSLDIEQLAAVDSICDWVSKAIGVADPVRTYHVNLSVFTSIPDFWGFSQLFPIVPIHRLDEKPTMRGILSDLTCDSDGKVDKFIGGESSLPLHEI---GSGDGGRYYLGMF 468          
BLAST of CX300194 vs. ExPASy Swiss-Prot
Match: SPE1_ARATH (Arginine decarboxylase 1 OS=Arabidopsis thaliana GN=SPE1 PE=2 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 3.374e-51
Identity = 95/124 (76.61%), Postives = 106/124 (85.48%), Query Frame = 3
Query:    6 DQLKQRCIEQFKDGTLGIEQLATVDGLCDFVAKEIGASDPVRTYHVNLSIFTSIPDYWAIGQLFPIVPIHHLDERPGVRGVLSDLTCDSDGKIDKFIGGGTSLPLHEMVGGGCGERGPYYLGMF 377
            DQLKQRC+E FK+G+LGIEQLA VDGLC++V K IGASDPV TYHVNLS+FTSIPD+W I QLFPIVPIH LD+RP  RG+LSDLTCDSDGKI+KFIGG +SLPLHEM   GC   G YYLGMF
Sbjct:  438 DQLKQRCVEGFKEGSLGIEQLAGVDGLCEWVIKAIGASDPVLTYHVNLSVFTSIPDFWGIDQLFPIVPIHKLDQRPAARGILSDLTCDSDGKINKFIGGESSLPLHEMDNNGC-SGGRYYLGMF 560          
BLAST of CX300194 vs. ExPASy Swiss-Prot
Match: SPE1_PEA (Arginine decarboxylase OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 2.418e-49
Identity = 89/124 (71.77%), Postives = 102/124 (82.26%), Query Frame = 3
Query:    6 DQLKQRCIEQFKDGTLGIEQLATVDGLCDFVAKEIGASDPVRTYHVNLSIFTSIPDYWAIGQLFPIVPIHHLDERPGVRGVLSDLTCDSDGKIDKFIGGGTSLPLHEMVGGGCGERGPYYLGMF 377
            +Q K+RC+E+FK GTLGIEQLA VDGLCD + + IG  DPV+ YHVNLS+FTS+PD+W I QLFPIVPIH LDE+P  RG+LSDLTCDSDGKIDKFIGG +SLPLHEM G G    G YYLGMF
Sbjct:  466 EQFKKRCVEEFKQGTLGIEQLAAVDGLCDLITETIGVKDPVKKYHVNLSVFTSVPDFWGINQLFPIVPIHRLDEKPTARGILSDLTCDSDGKIDKFIGGESSLPLHEMEGHG----GGYYLGMF 585          
BLAST of CX300194 vs. ExPASy Swiss-Prot
Match: SPE2_ARATH (Arginine decarboxylase 2 OS=Arabidopsis thaliana GN=SPE2 PE=2 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 7.035e-49
Identity = 91/124 (73.39%), Postives = 105/124 (84.68%), Query Frame = 3
Query:    6 DQLKQRCIEQFKDGTLGIEQLATVDGLCDFVAKEIGASDPVRTYHVNLSIFTSIPDYWAIGQLFPIVPIHHLDERPGVRGVLSDLTCDSDGKIDKFIGGGTSLPLHEMVGGGCGERGPYYLGMF 377
            DQLKQRC+E FK+G L IEQLA+VDGLC++V K IGASDPV TY++NLS+FTSIPD W I QLFPIVPIH LD+RPG RG+LSDLTCDSDGKI+KFIGG +SLPLHE+   G G  G Y+LGMF
Sbjct:  451 DQLKQRCVEGFKEGVLSIEQLASVDGLCEWVLKAIGASDPVHTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGARGILSDLTCDSDGKINKFIGGESSLPLHELDKNGSG--GRYFLGMF 572          
BLAST of CX300194 vs. ExPASy Swiss-Prot
Match: SPE1_BRAJU (Arginine decarboxylase OS=Brassica juncea GN=ADC1 PE=2 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 2.956e-47
Identity = 89/124 (71.77%), Postives = 103/124 (83.06%), Query Frame = 3
Query:    6 DQLKQRCIEQFKDGTLGIEQLATVDGLCDFVAKEIGASDPVRTYHVNLSIFTSIPDYWAIGQLFPIVPIHHLDERPGVRGVLSDLTCDSDGKIDKFIGGGTSLPLHEMVGGGCGERGPYYLGMF 377
            DQLKQRC+E+FK+G+L IEQLA VDGLC++V KEIG SDPV TY+VNLS+F SIPD+W I QLFPIVPIH LD+RP  RG+LSDLTCDSDGKI+KFIGG +SLPLHE+   G      YYLGMF
Sbjct:  444 DQLKQRCVEEFKEGSLSIEQLAGVDGLCEWVTKEIGGSDPVLTYNVNLSVFHSIPDFWGIDQLFPIVPIHRLDQRPVARGILSDLTCDSDGKINKFIGGESSLPLHELDNNG------YYLGMF 561          
BLAST of CX300194 vs. ExPASy Swiss-Prot
Match: SPE1_SOYBN (Arginine decarboxylase OS=Glycine max PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 4.719e-45
Identity = 83/124 (66.94%), Postives = 101/124 (81.45%), Query Frame = 3
Query:    6 DQLKQRCIEQFKDGTLGIEQLATVDGLCDFVAKEIGASDPVRTYHVNLSIFTSIPDYWAIGQLFPIVPIHHLDERPGVRGVLSDLTCDSDGKIDKFIGGGTSLPLHEMVGGGCGERGPYYLGMF 377
            +++K+RC+EQFK GT+ +EQLA V+GLC+ V K +GA++ VR YHVNLSIFTS+PD W I Q+FPI+PIH LDE+P VRG+LSDLTCDSDGKIDKFI G +SLPLHEM GG       YYLGMF
Sbjct:  454 EEMKERCVEQFKQGTVCMEQLAAVEGLCELVRKAVGAAESVRRYHVNLSIFTSVPDAWGIEQVFPIIPIHRLDEKPSVRGILSDLTCDSDGKIDKFINGESSLPLHEMEGG-----RTYYLGMF 572          
BLAST of CX300194 vs. ExPASy Swiss-Prot
Match: SPE1_DIACA (Arginine decarboxylase OS=Dianthus caryophyllus GN=ADC PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 4.719e-45
Identity = 85/122 (69.67%), Postives = 100/122 (81.97%), Query Frame = 3
Query:   12 LKQRCIEQFKDGTLGIEQLATVDGLCDFVAKEIGASDPVRTYHVNLSIFTSIPDYWAIGQLFPIVPIHHLDERPGVRGVLSDLTCDSDGKIDKFIGGGTSLPLHEMVGGGCGERGPYYLGMF 377
            LKQRC+E FKDG LG+EQLA VDGLC+ V+K +G +D V TY+VNLS+FTSIPD+W IGQLFPI+PIH LD++P  RG+LSDLTCDSDGKIDKFIG  +SLPLHE+ GG       YYLGMF
Sbjct:  465 LKQRCVELFKDGCLGMEQLAAVDGLCELVSKALGVADGVCTYNVNLSVFTSIPDFWGIGQLFPIMPIHRLDQQPKARGILSDLTCDSDGKIDKFIGDESSLPLHELSGG-----EGYYLGMF 581          
BLAST of CX300194 vs. ExPASy Swiss-Prot
Match: SPE1_ORYSJ (Arginine decarboxylase OS=Oryza sativa subsp. japonica GN=ADC1 PE=2 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 8.049e-45
Identity = 86/125 (68.80%), Postives = 101/125 (80.80%), Query Frame = 3
Query:    3 ADQLKQRCIEQFKDGTLGIEQLATVDGLCDFVAKEIGASDPVRTYHVNLSIFTSIPDYWAIGQLFPIVPIHHLDERPGVRGVLSDLTCDSDGKIDKFIGGGTSLPLHEMVGGGCGERGPYYLGMF 377
            ADQLK+RC +QFKDG LG+E LA VD LC+ VA+ +GA++P RTYH+NLS+FTS+PD WAIGQ+FPI+PI  L ERP V GVLSDLTCDSDGK+D FIGG  SLPLHE+     G RG YYLGMF
Sbjct:  453 ADQLKRRCADQFKDGVLGLEHLAAVDSLCEIVARGMGAAEPPRTYHINLSVFTSLPDMWAIGQMFPIIPIQRLGERPAVDGVLSDLTCDSDGKVDHFIGGRHSLPLHELPVH--GTRG-YYLGMF 574          
BLAST of CX300194 vs. ExPASy Swiss-Prot
Match: SPE2_THECC (Arginine decarboxylase (Fragment) OS=Theobroma cacao GN=SPE2 PE=3 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 8.330e-42
Identity = 77/97 (79.38%), Postives = 88/97 (90.72%), Query Frame = 3
Query:    3 ADQLKQRCIEQFKDGTLGIEQLATVDGLCDFVAKEIGASDPVRTYHVNLSIFTSIPDYWAIGQLFPIVPIHHLDERPGVRGVLSDLTCDSDGKIDKF 293
            ADQ KQRC+EQFK+GTLGIEQLA+VDGLC++V K IGASDPV TY++NLS+FTSIPD W I QLFPIVPIH LD+RPG RG+LSDLTCDSDGKI+KF
Sbjct:  310 ADQWKQRCVEQFKEGTLGIEQLASVDGLCEWVLKAIGASDPVHTYNINLSVFTSIPDLWGIDQLFPIVPIHKLDQRPGARGILSDLTCDSDGKINKF 406          
BLAST of CX300194 vs. ExPASy Swiss-Prot
Match: SPEA_ANASP (Biosynthetic arginine decarboxylase OS=Anabaena sp. (strain PCC 7120) GN=speA PE=3 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 1.250e-21
Identity = 61/144 (42.36%), Postives = 79/144 (54.86%), Query Frame = 3
Query:    3 ADQLKQRCIEQFKDGTLGIEQLATVDGLC--------------DFVAKEIGASDPVRT--YHVNLSIFTSIPDYWAIGQLFPIVPIHHLDERPGVRGVLSDLTCDSDGKIDKFI---GGGTSLPLHEMVGGGCGERGPYYLGMF 377
            A Q K+  I +F  G L + + A  + L               D+V  E+   + +    Y++NLS+F S PD WAI QLFPI+PIH LDE P  RG+L+DLTCDSDGKID+FI      + L LH    G      PYY+GMF
Sbjct:  444 ATQFKEEAISRFNLGILRLRERAKAERLYWACCQKILDIIRQHDYVPDELEDLEKIMASIYYINLSVFQSAPDCWAIDQLFPIMPIHRLDEEPTQRGILADLTCDSDGKIDRFIDLRDVKSVLELHPFQPG-----EPYYMGMF 582          
The following BLAST results are available for this feature:
BLAST of CX300194 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 99
Match NameE-valueIdentityDescription
SPE1_SOLLC2.583e-5173.60Arginine decarboxylase OS=Solanum lycopersicum PE=... [more]
SPE1_ARATH3.374e-5176.61Arginine decarboxylase 1 OS=Arabidopsis thaliana G... [more]
SPE1_PEA2.418e-4971.77Arginine decarboxylase OS=Pisum sativum PE=2 SV=1[more]
SPE2_ARATH7.035e-4973.39Arginine decarboxylase 2 OS=Arabidopsis thaliana G... [more]
SPE1_BRAJU2.956e-4771.77Arginine decarboxylase OS=Brassica juncea GN=ADC1 ... [more]
SPE1_SOYBN4.719e-4566.94Arginine decarboxylase OS=Glycine max PE=2 SV=1[more]
SPE1_DIACA4.719e-4569.67Arginine decarboxylase OS=Dianthus caryophyllus GN... [more]
SPE1_ORYSJ8.049e-4568.80Arginine decarboxylase OS=Oryza sativa subsp. japo... [more]
SPE2_THECC8.330e-4279.38Arginine decarboxylase (Fragment) OS=Theobroma cac... [more]
SPEA_ANASP1.250e-2142.36Biosynthetic arginine decarboxylase OS=Anabaena sp... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07007C10SK SaltLeaf1 Citrus clementina cDNA clone C07007C10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX300194 ID=CX300194|Name=CX300194|organism=Citrus clementina|type=EST|length=377bp
ATGCTGATCAATTGAAACAAAGATGCATTGAGCAATTTAAGGATGGGACT
TTAGGTATTGAACAGTTAGCTACTGTTGATGGGTTGTGTGATTTTGTAGC
TAAGGAAATAGGTGCATCTGATCCTGTTCGTACTTATCATGTGAATCTAT
CTATTTTCACTTCAATTCCGGATTATTGGGCCATTGGTCAGTTGTTTCCT
ATTGTTCCAATTCATCATTTGGATGAGAGGCCTGGAGTGAGGGGGGTTTT
ATCGGATTTGACTTGTGATAGTGATGGTAAGATTGATAAGTTCATTGGTG
GTGGTACGAGCTTGCCGTTACATGAAATGGTTGGTGGTGGTTGTGGTGAG
CGCGGGCCTTATTATTTGGGGATGTTC
back to top