CX300195

Overview
NameCX300195
Unique NameCX300195
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length445
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12170 contig Ccv1_Contig12170:1199..1643. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX300195 vs. ExPASy Swiss-Prot
Match: TBB9_ARATH (Tubulin beta-9 chain OS=Arabidopsis thaliana GN=TUBB9 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.467e-26
Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 3
Query:    3 MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV 173
            MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV
Sbjct:  363 MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV 419          
BLAST of CX300195 vs. ExPASy Swiss-Prot
Match: TBB8_MAIZE (Tubulin beta-8 chain OS=Zea mays GN=TUBB8 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.467e-26
Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 3
Query:    3 MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV 173
            MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV
Sbjct:  363 MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV 419          
BLAST of CX300195 vs. ExPASy Swiss-Prot
Match: TBB8_ARATH (Tubulin beta-8 chain OS=Arabidopsis thaliana GN=TUBB8 PE=2 SV=2)

HSP 1 Score: 118.242 bits (295), Expect = 1.467e-26
Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 3
Query:    3 MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV 173
            MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV
Sbjct:  363 MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV 419          
BLAST of CX300195 vs. ExPASy Swiss-Prot
Match: TBB7_ARATH (Tubulin beta-7 chain OS=Arabidopsis thaliana GN=TUBB7 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.467e-26
Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 3
Query:    3 MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV 173
            MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV
Sbjct:  363 MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV 419          
BLAST of CX300195 vs. ExPASy Swiss-Prot
Match: TBB6_MAIZE (Tubulin beta-6 chain OS=Zea mays GN=TUBB6 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.467e-26
Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 3
Query:    3 MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV 173
            MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV
Sbjct:  363 MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV 419          
BLAST of CX300195 vs. ExPASy Swiss-Prot
Match: TBB6_ARATH (Tubulin beta-6 chain OS=Arabidopsis thaliana GN=TUBB6 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.467e-26
Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 3
Query:    3 MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV 173
            MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV
Sbjct:  363 MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV 419          
BLAST of CX300195 vs. ExPASy Swiss-Prot
Match: TBB5_WHEAT (Tubulin beta-5 chain OS=Triticum aestivum GN=TUBB5 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.467e-26
Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 3
Query:    3 MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV 173
            MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV
Sbjct:  363 MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV 419          
BLAST of CX300195 vs. ExPASy Swiss-Prot
Match: TBB5_ORYSJ (Tubulin beta-5 chain OS=Oryza sativa subsp. japonica GN=TUBB5 PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.467e-26
Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 3
Query:    3 MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV 173
            MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV
Sbjct:  363 MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV 419          
BLAST of CX300195 vs. ExPASy Swiss-Prot
Match: TBB5_MAIZE (Tubulin beta-5 chain OS=Zea mays GN=TUBB5 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.467e-26
Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 3
Query:    3 MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV 173
            MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV
Sbjct:  363 MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV 419          
BLAST of CX300195 vs. ExPASy Swiss-Prot
Match: TBB4_ORYSJ (Tubulin beta-4 chain OS=Oryza sativa subsp. japonica GN=TUBB4 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.467e-26
Identity = 57/57 (100.00%), Postives = 57/57 (100.00%), Query Frame = 3
Query:    3 MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV 173
            MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV
Sbjct:  363 MASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV 419          
The following BLAST results are available for this feature:
BLAST of CX300195 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 231
Match NameE-valueIdentityDescription
TBB9_ARATH1.467e-26100.00Tubulin beta-9 chain OS=Arabidopsis thaliana GN=TU... [more]
TBB8_MAIZE1.467e-26100.00Tubulin beta-8 chain OS=Zea mays GN=TUBB8 PE=2 SV=... [more]
TBB8_ARATH1.467e-26100.00Tubulin beta-8 chain OS=Arabidopsis thaliana GN=TU... [more]
TBB7_ARATH1.467e-26100.00Tubulin beta-7 chain OS=Arabidopsis thaliana GN=TU... [more]
TBB6_MAIZE1.467e-26100.00Tubulin beta-6 chain OS=Zea mays GN=TUBB6 PE=2 SV=... [more]
TBB6_ARATH1.467e-26100.00Tubulin beta-6 chain OS=Arabidopsis thaliana GN=TU... [more]
TBB5_WHEAT1.467e-26100.00Tubulin beta-5 chain OS=Triticum aestivum GN=TUBB5... [more]
TBB5_ORYSJ1.467e-26100.00Tubulin beta-5 chain OS=Oryza sativa subsp. japoni... [more]
TBB5_MAIZE1.467e-26100.00Tubulin beta-5 chain OS=Zea mays GN=TUBB5 PE=2 SV=... [more]
TBB4_ORYSJ1.467e-26100.00Tubulin beta-4 chain OS=Oryza sativa subsp. japoni... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07007C11SK SaltLeaf1 Citrus clementina cDNA clone C07007C11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX300195 ID=CX300195|Name=CX300195|organism=Citrus clementina|type=EST|length=445bp
AGATGGCATCTACTTTTATTGGTAACTCAACATCCATCCAAGAGATGTTC
AGGAGGGTGAGTGAACAGTTTACTGCCATGTTCCGGCGTAAGGCCTTTTT
GCATTGGTATACTGGGGAGGGTATGGATGAGATGGAGTTCACTGAGGCAG
AGAGCAACATGAATGACTTGGTGGCTGAGTACCAACAATATCAGGATGCA
ACAGCTGATGATGAGGAAGAGTATGAGGAGGGCCTTGAGGAGAGCTTCGA
GGGCTAAGAAAGGGTAGCAATCAAAGGGCAACCACAGAAAAAGAACGCTT
GATGAGACCAACCCCCTTGTACTGTGGCTTCTTTTGTTGGTGATTACAAT
TTCTGTCTTTTAAGACGATATTGTTCGTTGTTCTTTTCGAGCATTCGAAT
AAAGAATTGCTAGTTTGATCACCTTTAAAAAAAAAAAAAAAAAAC
back to top