CX300196

Overview
NameCX300196
Unique NameCX300196
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length156
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig5796 contig Ccv1_Contig5796:1020..1175. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX300196 vs. ExPASy Swiss-Prot
Match: G3PA_SPIOL (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Spinacia oleracea GN=GAPA PE=1 SV=2)

HSP 1 Score: 90.8929 bits (224), Expect = 2.203e-18
Identity = 45/51 (88.24%), Postives = 47/51 (92.16%), Query Frame = 2
Query:    2 PNVSVVDLVDQVTKKTFVEEENAAFRESADNELKGILSVCYEPLVSVDFRC 154
            PNVSVVDLV QV+KKTF EE NAAFRESADNELKGILSVC EPLVS+DFRC
Sbjct:  303 PNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSIDFRC 353          
BLAST of CX300196 vs. ExPASy Swiss-Prot
Match: G3PA_TOBAC (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GAPA PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 5.426e-17
Identity = 43/51 (84.31%), Postives = 45/51 (88.24%), Query Frame = 2
Query:    2 PNVSVVDLVDQVTKKTFVEEENAAFRESADNELKGILSVCYEPLVSVDFRC 154
            PNVSVVDLV QV+KKTF EE NAAFRE+AD ELKGIL VC EPLVSVDFRC
Sbjct:  294 PNVSVVDLVVQVSKKTFAEEVNAAFREAADKELKGILDVCDEPLVSVDFRC 344          
BLAST of CX300196 vs. ExPASy Swiss-Prot
Match: G3PA_ARATH (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Arabidopsis thaliana GN=GAPA PE=1 SV=3)

HSP 1 Score: 84.7297 bits (208), Expect = 1.579e-16
Identity = 42/51 (82.35%), Postives = 45/51 (88.24%), Query Frame = 2
Query:    2 PNVSVVDLVDQVTKKTFVEEENAAFRESADNELKGILSVCYEPLVSVDFRC 154
            PNVSVVDLV QV+KKTF EE NAAFR+SA+ ELKGIL VC EPLVSVDFRC
Sbjct:  298 PNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRC 348          
BLAST of CX300196 vs. ExPASy Swiss-Prot
Match: G3PA_SINAL (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic (Fragment) OS=Sinapis alba GN=GAPA PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 3.517e-16
Identity = 41/51 (80.39%), Postives = 45/51 (88.24%), Query Frame = 2
Query:    2 PNVSVVDLVDQVTKKTFVEEENAAFRESADNELKGILSVCYEPLVSVDFRC 154
            PNVSVVDLV QV+KKTF EE NAAFR++A+ ELKGIL VC EPLVSVDFRC
Sbjct:  135 PNVSVVDLVVQVSKKTFAEEVNAAFRDAAEKELKGILDVCDEPLVSVDFRC 185          
BLAST of CX300196 vs. ExPASy Swiss-Prot
Match: G3PA_PEA (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Pisum sativum GN=GAPA PE=2 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 1.337e-15
Identity = 42/51 (82.35%), Postives = 43/51 (84.31%), Query Frame = 2
Query:    2 PNVSVVDLVDQVTKKTFVEEENAAFRESADNELKGILSVCYEPLVSVDFRC 154
            PNVSVVDLV QV+KKTF EE N AFRESA  EL GILSVC EPLVSVDFRC
Sbjct:  307 PNVSVVDLVVQVSKKTFAEEVNEAFRESAAKELTGILSVCDEPLVSVDFRC 357          
BLAST of CX300196 vs. ExPASy Swiss-Prot
Match: G3PA_MAIZE (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Zea mays GN=GAPA PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.251e-13
Identity = 38/51 (74.51%), Postives = 41/51 (80.39%), Query Frame = 2
Query:    2 PNVSVVDLVDQVTKKTFVEEENAAFRESADNELKGILSVCYEPLVSVDFRC 154
            PNVSVVDLV QV+KKT  EE N AFR++A NEL GIL VC  PLVSVDFRC
Sbjct:  305 PNVSVVDLVVQVSKKTLAEEVNQAFRDAAANELTGILEVCDVPLVSVDFRC 355          
BLAST of CX300196 vs. ExPASy Swiss-Prot
Match: G3PA_SCEVA (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic (Fragment) OS=Scenedesmus vacuolatus GN=GapA PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 2.359e-12
Identity = 36/51 (70.59%), Postives = 40/51 (78.43%), Query Frame = 2
Query:    2 PNVSVVDLVDQVTKKTFVEEENAAFRESADNELKGILSVCYEPLVSVDFRC 154
            PNVSVVDLV QV KKTF EE N AF+E+A   L G+L+V  EPLVSVDFRC
Sbjct:  233 PNVSVVDLVVQVEKKTFAEEINNAFKEAAAGSLNGVLAVSDEPLVSVDFRC 283          
BLAST of CX300196 vs. ExPASy Swiss-Prot
Match: G3PB_TOBAC (Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GAPB PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.256e-12
Identity = 36/52 (69.23%), Postives = 41/52 (78.85%), Query Frame = 2
Query:    2 PNVSVVDLVDQVTKKTFVEEE-NAAFRESADNELKGILSVCYEPLVSVDFRC 154
            PNVSVVDLV  V KK    E+ NAAFR++AD  LKG+L+VC EPLVSVDFRC
Sbjct:  293 PNVSVVDLVVNVAKKGITAEDVNAAFRKAADGPLKGVLAVCDEPLVSVDFRC 344          
BLAST of CX300196 vs. ExPASy Swiss-Prot
Match: G3PA_CHLRE (Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Chlamydomonas reinhardtii GN=GAPA PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.171e-11
Identity = 34/51 (66.67%), Postives = 40/51 (78.43%), Query Frame = 2
Query:    2 PNVSVVDLVDQVTKKTFVEEENAAFRESADNELKGILSVCYEPLVSVDFRC 154
            P VSVVDLV QV KKTF EE NAAFRE+A+  +KG+L V   PLVS+DF+C
Sbjct:  275 PTVSVVDLVVQVEKKTFAEEVNAAFREAANGPMKGVLHVEDAPLVSIDFKC 325          
The following BLAST results are available for this feature:
BLAST of CX300196 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
G3PA_SPIOL2.203e-1888.24Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PA_TOBAC5.426e-1784.31Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PA_ARATH1.579e-1682.35Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PA_SINAL3.517e-1680.39Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PA_PEA1.337e-1582.35Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PA_MAIZE1.251e-1374.51Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PA_SCEVA2.359e-1270.59Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
G3PB_TOBAC5.256e-1269.23Glyceraldehyde-3-phosphate dehydrogenase B, chloro... [more]
G3PA_CHLRE1.171e-1166.67Glyceraldehyde-3-phosphate dehydrogenase A, chloro... [more]
back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07007C12SK SaltLeaf1 Citrus clementina cDNA clone C07007C12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX300196 ID=CX300196|Name=CX300196|organism=Citrus clementina|type=EST|length=156bp
ACCAAACGTCTCGGTTGTTGATCTTGTCGATCAGGTGACGAAGAAAACCT
TCGTAGAAGAGGAGAACGCCGCTTTCAGAGAAAGCGCTGACAATGAACTG
AAAGGGATCCTCTCCGTGTGCTATGAGCCCCTCGTTTCGGTCGACTTCAG
GTGCTC
back to top