CX300199

Overview
NameCX300199
Unique NameCX300199
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length431
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX300199 vs. ExPASy Swiss-Prot
Match: IPYR_ORYSJ (Soluble inorganic pyrophosphatase OS=Oryza sativa subsp. japonica GN=IPP PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 7.013e-23
Identity = 50/59 (84.75%), Postives = 53/59 (89.83%), Query Frame = 2
Query:  254 PPVALNERILSSMSHRSVAAHPWHDLEIGPGAPAVCNCVVEIGKGGKVKYELDKASGLI 430
            PP ALNERILSSMS + VAAHPWHDLEIGPGAPAV NCVVEI +G KVKYELDKA+GLI
Sbjct:   16 PPAALNERILSSMSQKHVAAHPWHDLEIGPGAPAVFNCVVEIPRGSKVKYELDKATGLI 74          
BLAST of CX300199 vs. ExPASy Swiss-Prot
Match: IPYR_ORYSI (Soluble inorganic pyrophosphatase OS=Oryza sativa subsp. indica GN=IPP PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 7.013e-23
Identity = 50/59 (84.75%), Postives = 53/59 (89.83%), Query Frame = 2
Query:  254 PPVALNERILSSMSHRSVAAHPWHDLEIGPGAPAVCNCVVEIGKGGKVKYELDKASGLI 430
            PP ALNERILSSMS + VAAHPWHDLEIGPGAPAV NCVVEI +G KVKYELDKA+GLI
Sbjct:   16 PPAALNERILSSMSQKHVAAHPWHDLEIGPGAPAVFNCVVEIPRGSKVKYELDKATGLI 74          
BLAST of CX300199 vs. ExPASy Swiss-Prot
Match: IPYR2_ARATH (Soluble inorganic pyrophosphatase 2 OS=Arabidopsis thaliana GN=PPA2 PE=2 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 7.258e-20
Identity = 45/59 (76.27%), Postives = 48/59 (81.36%), Query Frame = 2
Query:  254 PPVALNERILSSMSHRSVAAHPWHDLEIGPGAPAVCNCVVEIGKGGKVKYELDKASGLI 430
            P V LNER  ++ +HRS AAHPWHDLEIGP AP V NCVVEI KGGKVKYELDK SGLI
Sbjct:   20 PNVTLNERNFAAFTHRSAAAHPWHDLEIGPEAPTVFNCVVEISKGGKVKYELDKNSGLI 78          
BLAST of CX300199 vs. ExPASy Swiss-Prot
Match: IPYR_MAIZE (Soluble inorganic pyrophosphatase OS=Zea mays GN=IPP PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.238e-19
Identity = 51/74 (68.92%), Postives = 53/74 (71.62%), Query Frame = 2
Query:  209 MSNHLGTAGSNNSGGPPVALNERILSSMSHRSVAAHPWHDLEIGPGAPAVCNCVVEIGKGGKVKYELDKASGLI 430
            MS    TA S         LNERILSS+S RSVAAHPWHDLEIGP APAV N VVEI KG KVKYELDK +GLI
Sbjct:    1 MSEEDKTAASAEQPKRAPKLNERILSSLSRRSVAAHPWHDLEIGPDAPAVFNVVVEITKGSKVKYELDKKTGLI 74          
BLAST of CX300199 vs. ExPASy Swiss-Prot
Match: IPYR_SOLTU (Soluble inorganic pyrophosphatase OS=Solanum tuberosum GN=PPA PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.048e-18
Identity = 44/55 (80.00%), Postives = 48/55 (87.27%), Query Frame = 2
Query:  266 LNERILSSMSHRSVAAHPWHDLEIGPGAPAVCNCVVEIGKGGKVKYELDKASGLI 430
            LNERILSS+S RSVAAHPWHDLEIGP AP+V N V+EI KG KVKYELDK +GLI
Sbjct:   17 LNERILSSISRRSVAAHPWHDLEIGPEAPSVFNVVIEISKGSKVKYELDKKTGLI 71          
BLAST of CX300199 vs. ExPASy Swiss-Prot
Match: IPYR_HORVD (Soluble inorganic pyrophosphatase OS=Hordeum vulgare var. distichum GN=IPP PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.048e-18
Identity = 46/67 (68.66%), Postives = 49/67 (73.13%), Query Frame = 2
Query:  230 AGSNNSGGPPVALNERILSSMSHRSVAAHPWHDLEIGPGAPAVCNCVVEIGKGGKVKYELDKASGLI 430
            A    +  P   LNERILSS+S R   AHPWHDLEIGPGAPAV N VVEI KG KVKYELDK +GLI
Sbjct:   11 AAQQPTSRPAPKLNERILSSLSRRGGGAHPWHDLEIGPGAPAVFNVVVEITKGSKVKYELDKKTGLI 77          
The following BLAST results are available for this feature:
BLAST of CX300199 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
IPYR_ORYSJ7.013e-2384.75Soluble inorganic pyrophosphatase OS=Oryza sativa ... [more]
IPYR_ORYSI7.013e-2384.75Soluble inorganic pyrophosphatase OS=Oryza sativa ... [more]
IPYR2_ARATH7.258e-2076.27Soluble inorganic pyrophosphatase 2 OS=Arabidopsis... [more]
IPYR_MAIZE1.238e-1968.92Soluble inorganic pyrophosphatase OS=Zea mays GN=I... [more]
IPYR_SOLTU1.048e-1880.00Soluble inorganic pyrophosphatase OS=Solanum tuber... [more]
IPYR_HORVD1.048e-1868.66Soluble inorganic pyrophosphatase OS=Hordeum vulga... [more]
back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07007D03SK SaltLeaf1 Citrus clementina cDNA clone C07007D03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX300199 ID=CX300199|Name=CX300199|organism=Citrus clementina|type=EST|length=431bp
CAGGAATTCGGCACGAGGGCATAGAGGTCTCAGCTTCACAGTGTTTCTCC
ATCGGTGTGTAATATTGGGTCACGCGAGAGCGAGAAAGCTCTTAGGCCCT
CTCCTATCCGGTCCCCGAAACAAAGGCAAGGCAGCGGCTTGCTAAATACA
TATCAAGTGGAAGTGCGTTTGTCATTGCCAACTGTGAATCTTGTATGATT
TGTACGAAATGAGTAACCATCTTGGAACCGCCGGCAGCAATAACTCAGGA
GGCCCTCCAGTGGCTCTTAACGAAAGGATACTTTCTTCAATGTCGCACAG
ATCAGTTGCAGCTCATCCATGGCATGACTTGGAAATTGGACCAGGCGCAC
CGGCAGTTTGCAACTGTGTGGTGGAAATTGGGAAGGGTGGCAAGGTGAAG
TATGAGCTTGACAAGGCTAGCGGTCTTATCA
back to top