CX300200

Overview
NameCX300200
Unique NameCX300200
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length428
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig830 contig Ccv1_Contig830:1..428. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX300200 vs. ExPASy Swiss-Prot
Match: CP74A_ARATH (Allene oxide synthase, chloroplastic OS=Arabidopsis thaliana GN=CYP74A PE=1 SV=3)

HSP 1 Score: 70.0922 bits (170), Expect = 4.152e-12
Identity = 35/74 (47.30%), Postives = 49/74 (66.22%), Query Frame = 1
Query:    7 GEKGSELLSYLYWSNGPQTGTPNDMNKQCAGKDYVTLVACLIVAYVFQRYESI--------TGNSSSITAVEKA 204
            GE+G +LL ++ WSNGP+T TP   NKQCAGKD+V LVA L V  +F+RY+S          G+S + +++ KA
Sbjct:  443 GEEGEKLLRHVLWSNGPETETPTVGNKQCAGKDFVVLVARLFVIEIFRRYDSFDIEVGTSPLGSSVNFSSLRKA 516          
BLAST of CX300200 vs. ExPASy Swiss-Prot
Match: C74A1_ORYSJ (Allene oxide synthase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=CYP74A1 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 2.692e-11
Identity = 33/74 (44.59%), Postives = 49/74 (66.22%), Query Frame = 1
Query:    7 GEKGSELLSYLYWSNGPQTGTPNDMNKQCAGKDYVTLVACLIVAYVFQRYESI--------TGNSSSITAVEKA 204
            GE G+ LL ++ WSNGP+T  P   +KQCAGKD+V LVA L++  +F RY+S          G+S ++T+++KA
Sbjct:  437 GEDGARLLRHVVWSNGPETAAPTLHDKQCAGKDFVVLVARLLLVELFLRYDSFDVEVGTSTLGSSVTVTSLKKA 510          
The following BLAST results are available for this feature:
BLAST of CX300200 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
CP74A_ARATH4.152e-1247.30Allene oxide synthase, chloroplastic OS=Arabidopsi... [more]
C74A1_ORYSJ2.692e-1144.59Allene oxide synthase 1, chloroplastic OS=Oryza sa... [more]
back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07007D04SK SaltLeaf1 Citrus clementina cDNA clone C07007D04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX300200 ID=CX300200|Name=CX300200|organism=Citrus clementina|type=EST|length=428bp
CGAGGGGGCGAAAAGGGGAGCGAGTTGTTGAGTTACTTGTATTGGTCAAA
TGGGCCACAGACGGGGACTCCCAATGACATGAACAAGCAGTGTGCCGGAA
AGGATTACGTGACTCTCGTTGCTTGTTTGATCGTGGCTTATGTGTTCCAA
AGGTACGAGTCTATTACTGGGAACTCATCTTCGATCACGGCCGTTGAAAA
GGCCAAGTGATGGTGATTTTGAACGTGAGCATCATCACGTGAATGGGGTC
GTATGACGGTGATGGATCGTGAACGTAACGTCGAGTTGTAACGTTTGTCT
GGTTTGGTTGTTAATAGAGAAAGTTATGTAGAGATGGGTCCCACCGGTTC
CCTTGGATGTAGTAGTAGCGAACCGGTGAATGAATAAAAAAGTCTCGTGG
ATGATAAAAAAAAAAAAAAAAAAAAAAA
back to top