CX300201

Overview
NameCX300201
Unique NameCX300201
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length466
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX300201 vs. ExPASy Swiss-Prot
Match: B3GT2_ARATH (Probable beta-1,3-galactosyltransferase 2 OS=Arabidopsis thaliana GN=B3GALT2 PE=2 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 5.453e-57
Identity = 98/105 (93.33%), Postives = 104/105 (99.05%), Query Frame = 2
Query:    2 ATGQLYAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF 316
            ATGQLYAIS+DLA+YISINQHVLHKYANEDVSLG+WFIG+DV+HIDDRRLCCGTPPDCEWKAQAGNICVASFDW+CSGICRSADRIKEVHRRCGEGE ALWSATF
Sbjct:  303 ATGQLYAISRDLASYISINQHVLHKYANEDVSLGAWFIGIDVKHIDDRRLCCGTPPDCEWKAQAGNICVASFDWSCSGICRSADRIKEVHRRCGEGEKALWSATF 407          
BLAST of CX300201 vs. ExPASy Swiss-Prot
Match: B3GT3_ARATH (Probable beta-1,3-galactosyltransferase 3 OS=Arabidopsis thaliana GN=B3GALT3 PE=2 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 6.666e-55
Identity = 94/105 (89.52%), Postives = 101/105 (96.19%), Query Frame = 2
Query:    2 ATGQLYAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF 316
            ATGQLYAIS+DLA+YIS+NQHVLHKYANEDV+LG+WFIGLDV HIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVH+RCGE ENA+W A F
Sbjct:  305 ATGQLYAISRDLASYISLNQHVLHKYANEDVTLGAWFIGLDVTHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHKRCGEPENAIWKARF 409          
BLAST of CX300201 vs. ExPASy Swiss-Prot
Match: B3GT4_ARATH (Probable beta-1,3-galactosyltransferase 4 OS=Arabidopsis thaliana GN=B3GALT4 PE=1 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 8.432e-50
Identity = 89/105 (84.76%), Postives = 100/105 (95.24%), Query Frame = 2
Query:    2 ATGQLYAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF 316
            ATGQLYAIS++LA+YISINQ+VLHKY NEDVSLGSWF+GLDVEH+DDRRLCCGT  DCEWKAQAGNICVASFDW+CSGICRSADR+K+VHRRCGEGE AL +A+F
Sbjct:  304 ATGQLYAISRELASYISINQNVLHKYVNEDVSLGSWFLGLDVEHVDDRRLCCGT-TDCEWKAQAGNICVASFDWSCSGICRSADRMKDVHRRCGEGEKALLAASF 407          
BLAST of CX300201 vs. ExPASy Swiss-Prot
Match: B3GT6_ARATH (Probable beta-1,3-galactosyltransferase 6 OS=Arabidopsis thaliana GN=B3GALT6 PE=2 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 3.543e-48
Identity = 82/105 (78.10%), Postives = 94/105 (89.52%), Query Frame = 2
Query:    2 ATGQLYAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF 316
            ATGQ+YAISKDLA YIS+N+ +LHKYANEDVSLGSWFIGLDVEHIDDR LCCGTP DCEWK QAGN C ASFDW+CSGIC+S DR+ EVH+RCGEG+ A+W ++F
Sbjct:  295 ATGQIYAISKDLATYISVNRQLLHKYANEDVSLGSWFIGLDVEHIDDRSLCCGTPLDCEWKGQAGNPCAASFDWSCSGICKSVDRMLEVHQRCGEGDGAIWHSSF 399          
BLAST of CX300201 vs. ExPASy Swiss-Prot
Match: B3GT7_ARATH (Beta-1,3-galactosyltransferase 7 OS=Arabidopsis thaliana GN=B3GALT7 PE=2 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 9.648e-46
Identity = 78/102 (76.47%), Postives = 91/102 (89.22%), Query Frame = 2
Query:    2 ATGQLYAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGENALWS 307
            ATGQ+YAISKDLA YISINQ +LHKYANEDVSLGSWFIGL+VEHIDDR  CCGTPPDC WKA+AG++CVASF+W+CSGIC+S +R+K VH  C EGE A+W+
Sbjct:  289 ATGQIYAISKDLANYISINQPILHKYANEDVSLGSWFIGLEVEHIDDRNFCCGTPPDCRWKAEAGDVCVASFEWSCSGICKSVERMKIVHEVCSEGEGAVWN 390          
BLAST of CX300201 vs. ExPASy Swiss-Prot
Match: B3GT8_ARATH (Probable beta-1,3-galactosyltransferase 8 OS=Arabidopsis thaliana GN=B3GALT8 PE=2 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 1.540e-43
Identity = 73/105 (69.52%), Postives = 89/105 (84.76%), Query Frame = 2
Query:    2 ATGQLYAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSATF 316
            ATGQ+YAISKDLA YIS NQ +LH+YANEDVSLG+W +GL+VEH+D+R +CCGTPPDC+WKAQAGN+C ASFDW+CSGIC+S DR+  VHR C EG+  L +  F
Sbjct:  289 ATGQIYAISKDLATYISTNQGILHRYANEDVSLGAWMLGLEVEHVDERSMCCGTPPDCQWKAQAGNVCAASFDWSCSGICKSVDRMARVHRACAEGDTPLANFRF 393          
BLAST of CX300201 vs. ExPASy Swiss-Prot
Match: B3GT1_ARATH (Probable beta-1,3-galactosyltransferase 1 OS=Arabidopsis thaliana GN=B3GALT1 PE=2 SV=2)

HSP 1 Score: 171.785 bits (434), Expect = 1.304e-42
Identity = 75/103 (72.82%), Postives = 88/103 (85.44%), Query Frame = 2
Query:    2 ATGQLYAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSA 310
            ATGQ YAISKDLA YI INQ +LHKYANEDVSLGSWFIGL+VEH+D++RLCC T  DCE KA  G++C ASFDW CSGICRSA+R+ +VH RCGE +NALW++
Sbjct:  280 ATGQFYAISKDLATYILINQDLLHKYANEDVSLGSWFIGLNVEHVDEKRLCCSTSQDCELKAMMGHVCAASFDWKCSGICRSAERMADVHERCGEPQNALWTS 382          
BLAST of CX300201 vs. ExPASy Swiss-Prot
Match: B3GT5_ARATH (Probable beta-1,3-galactosyltransferase 5 OS=Arabidopsis thaliana GN=B3GALT5 PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 1.703e-42
Identity = 75/103 (72.82%), Postives = 86/103 (83.50%), Query Frame = 2
Query:    2 ATGQLYAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQAGNICVASFDWTCSGICRSADRIKEVHRRCGEGENALWSA 310
            ATGQ+YAISKDLA YIS NQ +LHKYANEDV+LGSWFIGL+VE IDDR  CCGTPPDCE +A+AG +CVA+FDW CSG+CRS DR+  VH  CGEG  A+W A
Sbjct:  291 ATGQIYAISKDLATYISNNQPILHKYANEDVTLGSWFIGLEVEQIDDRNFCCGTPPDCEMRAEAGEMCVATFDWKCSGVCRSVDRMWMVHVMCGEGSKAVWDA 393          
BLAST of CX300201 vs. ExPASy Swiss-Prot
Match: B3GTB_ARATH (Probable beta-1,3-galactosyltransferase 11 OS=Arabidopsis thaliana GN=B3GALT11 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 3.700e-13
Identity = 30/64 (46.88%), Postives = 46/64 (71.88%), Query Frame = 2
Query:    2 ATGQLYAISKDLAAYISINQHVLHKYANEDVSLGSWFIGLDVEHIDDRRLCCGTPPDCEWKAQA 193
            A G++Y I+  LA ++SIN+ +LH YA++DVS GSWF+GLDV+H+D+ + CC       W ++A
Sbjct:  275 AYGEMYVITHALARFVSINRDILHSYAHDDVSTGSWFVGLDVKHVDEGKFCCSA-----WSSEA 333          
The following BLAST results are available for this feature:
BLAST of CX300201 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
B3GT2_ARATH5.453e-5793.33Probable beta-1,3-galactosyltransferase 2 OS=Arabi... [more]
B3GT3_ARATH6.666e-5589.52Probable beta-1,3-galactosyltransferase 3 OS=Arabi... [more]
B3GT4_ARATH8.432e-5084.76Probable beta-1,3-galactosyltransferase 4 OS=Arabi... [more]
B3GT6_ARATH3.543e-4878.10Probable beta-1,3-galactosyltransferase 6 OS=Arabi... [more]
B3GT7_ARATH9.648e-4676.47Beta-1,3-galactosyltransferase 7 OS=Arabidopsis th... [more]
B3GT8_ARATH1.540e-4369.52Probable beta-1,3-galactosyltransferase 8 OS=Arabi... [more]
B3GT1_ARATH1.304e-4272.82Probable beta-1,3-galactosyltransferase 1 OS=Arabi... [more]
B3GT5_ARATH1.703e-4272.82Probable beta-1,3-galactosyltransferase 5 OS=Arabi... [more]
B3GTB_ARATH3.700e-1346.88Probable beta-1,3-galactosyltransferase 11 OS=Arab... [more]
back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07007D05SK SaltLeaf1 Citrus clementina cDNA clone C07007D05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX300201 ID=CX300201|Name=CX300201|organism=Citrus clementina|type=EST|length=466bp
TGCAACTGGACAGCTTTATGCCATTTCAAAAGATTTGGCTGCATATATAT
CAATAAACCAGCATGTTCTACACAAGTATGCTAATGAGGATGTTTCATTG
GGATCATGGTTCATTGGACTTGATGTAGAGCATATTGATGACCGAAGACT
ATGCTGTGGCACTCCACCTGACTGTGAGTGGAAGGCTCAGGCAGGCAACA
TTTGTGTTGCTTCATTTGATTGGACTTGCAGCGGAATTTGTAGGTCTGCT
GATAGGATTAAGGAGGTCCATCGGCGGTGCGGTGAAGGTGAAAATGCTTT
ATGGAGTGCTACATTCTAACAAGTCTGTTGAAAAATCTTCCAAACTCTGG
AAGATTGCAAAATAGGGTGAAAGAAGCTGGTGTGCAATTCTTTTTCTGTG
GTTTTATTCGAGTATAGGGAATTATATATACATATCACAAAAGATAGAAA
ATGAGAGAGAGGGAGA
back to top