CX300207

Overview
NameCX300207
Unique NameCX300207
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length448
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9464 contig Ccv1_Contig9464:570..1017. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: AUHM_DICDI (Methylglutaconyl-CoA hydratase, mitochondrial OS=Dictyostelium discoideum GN=auh PE=3 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 4.172e-40
Identity = 82/143 (57.34%), Postives = 106/143 (74.13%), Query Frame = 2
Query:    5 LACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEEECYIGTLHTEDRLEGLAAFAEKRKPKYTG 433
            LACD R+  +++ +GLPETGLAIIPGAGGTQRLPRL+G   AK++IFTG  +  K A+ +GLV Y    G+A  KA+EIA++I  KGPIAIRMAK+AI +G+ VD AS + +E+  Y   + T+DR+EGL AF EKRKP Y G
Sbjct:  160 LACDFRVASKSSKMGLPETGLAIIPGAGGTQRLPRLIGIPRAKELIFTGAILDSKRALEIGLVQYETEKGEAFDKAIEIAKQIIPKGPIAIRMAKQAIDRGMNVDQASGMIIEQASYAQVIPTKDRIEGLTAFKEKRKPIYKG 302          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: YNGF_BACSU (Putative enoyl-CoA hydratase/isomerase yngF OS=Bacillus subtilis GN=yngF PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 7.116e-40
Identity = 83/144 (57.64%), Postives = 104/144 (72.22%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEEECYIGTLHTEDRLEGLAAFAEKRKPKYTG 433
            ALACDLRI  EAA+LGLPETGLAIIPGAGGTQRLPRL+G+  AK+ I+TGR+V+  +A  +GLV +         KA E+A  I+  GPIA+R AK AI KGLE D+A+ L +E++ Y  T+ T+DR EGL AF EKR+  Y G
Sbjct:  116 ALACDLRIATEAAVLGLPETGLAIIPGAGGTQRLPRLIGRGKAKEFIYTGRRVTAHEAKEIGLVEHVTAPCDLMPKAEELAAAISANGPIAVRQAKFAINKGLETDLATGLAIEQKAYEQTIPTKDRREGLQAFQEKRRAVYKG 259          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: AUHM_HUMAN (Methylglutaconyl-CoA hydratase, mitochondrial OS=Homo sapiens GN=AUH PE=1 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 2.289e-38
Identity = 77/148 (52.03%), Postives = 109/148 (73.65%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQ----AQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEEECYIGTLHTEDRLEGLAAFAEKRKPKYTG 433
            ALACD+R+   +A +GL ET LAIIPG GGTQRLPR +G S+AK++IF+ R + GK+A ++GL+++ +   Q    A  KAL++A+E   +GP+A+R+AK AI +G+EVD+ + L +EE CY  T+ T+DRLEGL AF EKR P+Y G
Sbjct:  191 ALACDIRVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLAREFLPQGPVAMRVAKLAINQGMEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYKG 338          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: ECHD2_MOUSE (Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Mus musculus GN=Echdc2 PE=2 SV=2)

HSP 1 Score: 156.762 bits (395), Expect = 3.904e-38
Identity = 78/148 (52.70%), Postives = 108/148 (72.97%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQ----AQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEEECYIGTLHTEDRLEGLAAFAEKRKPKYTG 433
            ALACDLRI   +A++GL ET   ++PGAGGTQRLPR +G ++AK++IFTGR+++G  A  LGLVN+ V   +    A  +AL +AQEI  + PIA+R+ K AI +G+EVD+AS + +E+ CY   + T+DRLEG+AAF EKR PK+ G
Sbjct:  148 ALACDLRIAASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELIFTGRRLNGAQARELGLVNHAVAQNEEGNAAYHRALALAQEILPQAPIAVRLGKVAIDRGMEVDIASGMAIEQMCYAQNIPTQDRLEGMAAFREKRAPKFVG 295          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: AUHM_MOUSE (Methylglutaconyl-CoA hydratase, mitochondrial OS=Mus musculus GN=Auh PE=2 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 5.099e-38
Identity = 76/148 (51.35%), Postives = 109/148 (73.65%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQ----AQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEEECYIGTLHTEDRLEGLAAFAEKRKPKYTG 433
            ALACD+R+   +A +GL ET LAIIPG GGTQRLPR +G S+AK++IF+ R + G++A ++GL+++ +   Q    A  KAL++A+E   +GP+A+R+AK AI +G+EVD+ + L +EE CY  T+ T+DRLEGL AF EKR P+Y G
Sbjct:  166 ALACDIRVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGQEAKAVGLISHVLEQNQEGDAAYRKALDLAREFLPQGPVAMRVAKLAINQGMEVDLVTGLAIEEACYAQTISTKDRLEGLLAFKEKRPPRYKG 313          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: ECHD2_BOVIN (Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Bos taurus GN=ECHDC2 PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 9.617e-37
Identity = 76/148 (51.35%), Postives = 107/148 (72.30%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQ----AQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEEECYIGTLHTEDRLEGLAAFAEKRKPKYTG 433
            ALACDLR+   +A++GL ET   ++PGAGGTQRLPR +G ++AK++IFTGR++SG  A +LGLVN+ V   +    A  +A  +AQEI  + PIA+R++K AI +G+EVD+AS + +E  CY   + T DRLEG+AAF EKR P++ G
Sbjct:  148 ALACDLRVAASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELIFTGRRLSGAQAQALGLVNHAVAQNEEGNAAYHRARALAQEILPQAPIAVRLSKVAIDRGIEVDIASGMAIEGICYAQNIPTRDRLEGMAAFREKRLPRFVG 295          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: ECHD2_HUMAN (Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Homo sapiens GN=ECHDC2 PE=2 SV=2)

HSP 1 Score: 151.754 bits (382), Expect = 1.256e-36
Identity = 77/148 (52.03%), Postives = 105/148 (70.95%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQ----AQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEEECYIGTLHTEDRLEGLAAFAEKRKPKYTG 433
            ALACDLR+   +A++GL ET   ++PGAGGTQRLPR +G ++AK++IFTGR++SG +A  LGLVN+ V   +    A  +A  +AQEI  + PIA+R+ K AI +G EVD+AS + +E  CY   + T DRLEG+AAF EKR PK+ G
Sbjct:  144 ALACDLRVAASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELIFTGRRLSGTEAHVLGLVNHAVAQNEEGDAAYQRARALAQEILPQAPIAVRLGKVAIDRGTEVDIASGMAIEGMCYAQNIPTRDRLEGMAAFREKRTPKFVG 291          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: CRT_CLOAB (3-hydroxybutyryl-CoA dehydratase OS=Clostridium acetobutylicum GN=crt PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 8.160e-28
Identity = 60/139 (43.17%), Postives = 87/139 (62.59%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEEECYIGTLHTEDRLEGLAAFAEKRK 418
            A++CD+RI    A  G PE GL I PG GGTQRL RLVG  +AK +IFT + +   +A+ +GLVN  V   +    A EIA +I    P+A++++K+AI +G++ D+ +AL  E E +     TED+ + + AF EKRK
Sbjct:  116 AMSCDIRIASSNARFGQPEVGLGITPGFGGTQRLSRLVGMGMAKQLIFTAQNIKADEALRIGLVNKVVEPSELMNTAKEIANKIVSNAPVAVKLSKQAINRGMQCDIDTALAFESEAFGECFSTEDQKDAMTAFIEKRK 254          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: ECHM_BOVIN (Enoyl-CoA hydratase, mitochondrial OS=Bos taurus GN=ECHS1 PE=2 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 2.010e-26
Identity = 59/142 (41.55%), Postives = 86/142 (60.56%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEEECYIGTLHTEDRLEGLAAFAEKRKPKY 427
            A+ CD+   GE A  G PE  +  IPGAGGTQRL R VGKS+A +++ TG ++S +DA   GLV+   P      +A++ A++I     I   MAK ++    E+ +A  ++LE++ +  T  TEDR EG+AAF EKRK  +
Sbjct:  146 AMMCDIIYAGEKAQFGQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETVVEEAIQCAEKIASNSKIVTAMAKESVNAAFEMTLAEGVKLEKKLFYSTFATEDRKEGMAAFVEKRKANF 287          
BLAST of CX300207 vs. ExPASy Swiss-Prot
Match: ECHM_CAEEL (Probable enoyl-CoA hydratase, mitochondrial OS=Caenorhabditis elegans GN=ech-6 PE=1 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 2.625e-26
Identity = 57/142 (40.14%), Postives = 85/142 (59.86%), Query Frame = 2
Query:    2 ALACDLRICGEAALLGLPETGLAIIPGAGGTQRLPRLVGKSVAKDIIFTGRKVSGKDAMSLGLVNYCVPAGQAQLKALEIAQEINQKGPIAIRMAKRAITKGLEVDMASALELEEECYIGTLHTEDRLEGLAAFAEKRKPKY 427
            A+ CD+   GE A  G PE  +  IPGAGGTQR  R  GKS A ++  TG  V+ ++A   G+V+   PA Q   +A+++ ++I  + P+ ++MAK A+ K  E+ +   L  E   +  T  T+DR EG+ AFAEKRKP++
Sbjct:  144 AMMCDIIYAGEKARFGQPEINIGTIPGAGGTQRWARAAGKSFAMEVCLTGNHVTAQEAKEHGIVSKIFPADQVVGEAVKLGEKIADQSPLIVQMAKEAVNKAYELTLQEGLHFERRLFHATFATKDRKEGMTAFAEKRKPQW 285          
The following BLAST results are available for this feature:
BLAST of CX300207 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 172
Match NameE-valueIdentityDescription
AUHM_DICDI4.172e-4057.34Methylglutaconyl-CoA hydratase, mitochondrial OS=D... [more]
YNGF_BACSU7.116e-4057.64Putative enoyl-CoA hydratase/isomerase yngF OS=Bac... [more]
AUHM_HUMAN2.289e-3852.03Methylglutaconyl-CoA hydratase, mitochondrial OS=H... [more]
ECHD2_MOUSE3.904e-3852.70Enoyl-CoA hydratase domain-containing protein 2, m... [more]
AUHM_MOUSE5.099e-3851.35Methylglutaconyl-CoA hydratase, mitochondrial OS=M... [more]
ECHD2_BOVIN9.617e-3751.35Enoyl-CoA hydratase domain-containing protein 2, m... [more]
ECHD2_HUMAN1.256e-3652.03Enoyl-CoA hydratase domain-containing protein 2, m... [more]
CRT_CLOAB8.160e-2843.173-hydroxybutyryl-CoA dehydratase OS=Clostridium ac... [more]
ECHM_BOVIN2.010e-2641.55Enoyl-CoA hydratase, mitochondrial OS=Bos taurus G... [more]
ECHM_CAEEL2.625e-2640.14Probable enoyl-CoA hydratase, mitochondrial OS=Cae... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07007D11SK SaltLeaf1 Citrus clementina cDNA clone C07007D11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX300207 ID=CX300207|Name=CX300207|organism=Citrus clementina|type=EST|length=448bp
GGCACTAGCATGTGATCTTCGCATCTGTGGAGAAGCAGCACTATTGGGCT
TGCCTGAAACAGGACTTGCTATAATTCCTGGGGCGGGTGGGACACAGCGG
CTTCCAAGATTAGTTGGAAAATCAGTAGCAAAAGATATTATATTTACTGG
CCGTAAAGTTAGTGGCAAAGATGCAATGTCTTTAGGTCTTGTCAATTACT
GTGTTCCTGCTGGTCAAGCTCAGCTGAAGGCACTTGAAATTGCTCAGGAA
ATAAATCAGAAGGGTCCGATCGCCATTAGGATGGCTAAAAGGGCTATTAC
TAAGGGATTGGAGGTGGATATGGCATCAGCATTGGAACTGGAAGAAGAGT
GCTACATTGGGACCTTGCATACAGAGGATCGGTTGGAGGGCTTGGCTGCA
TTTGCCGAGAAGCGGAAACCCAAGTACACCGGCACATAGAGAGAAAGA
back to top