CX300208

Overview
NameCX300208
Unique NameCX300208
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length437
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9186 contig Ccv1_Contig9186:4..441. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX300208 vs. ExPASy Swiss-Prot
Match: MT3_CARPA (Metallothionein-like protein type 3 OS=Carica papaya PE=3 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 4.964e-24
Identity = 46/66 (69.70%), Postives = 55/66 (83.33%), Query Frame = 1
Query:   64 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 261
            MSDTCGNCDCAD++QCVKKGSSY AD +ET+ S ++  VVMD  AAE +G CKCGP+C+C NCTCG
Sbjct:    1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEKSIMT--VVMDAPAAENDGKCKCGPSCSCTNCTCG 64          
BLAST of CX300208 vs. ExPASy Swiss-Prot
Match: MT3_MUSAC (Metallothionein-like protein type 3 OS=Musa acuminata PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.682e-19
Identity = 39/64 (60.94%), Postives = 48/64 (75.00%), Query Frame = 1
Query:   73 TCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCGS 264
            TCGNCDC D+SQCVKKG+SY  D VET+ S+V  V+V   +AAE +G CKCG  CAC +C CG+
Sbjct:    3 TCGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIVA-AEAAEHDGKCKCGAACACTDCKCGN 65          
BLAST of CX300208 vs. ExPASy Swiss-Prot
Match: MT3_ACTDE (Metallothionein-like protein type 3 OS=Actinidia deliciosa GN=pKIWI503 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 4.808e-19
Identity = 44/65 (67.69%), Postives = 49/65 (75.38%), Query Frame = 1
Query:   64 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTC 258
            MSD CGNCDCAD SQCVKKG+S   D VETD S++  VV M V AAE+ G CKCG +C CVNCTC
Sbjct:    1 MSDKCGNCDCADSSQCVKKGNSI--DIVETDKSYIEDVV-MGVPAAESGGKCKCGTSCPCVNCTC 62          
BLAST of CX300208 vs. ExPASy Swiss-Prot
Match: MT3_PRUAV (Metallothionein-like protein 1 OS=Prunus avium GN=MT1 PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 7.677e-17
Identity = 38/65 (58.46%), Postives = 45/65 (69.23%), Query Frame = 1
Query:   64 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTC 258
            MS  C NCDC+D SQC KKG S+    VET+   + TV+ MD  AAE  GNCKCGP+CACV+C C
Sbjct:    1 MSSKCSNCDCSDSSQCTKKGYSFDLVIVETENRSMDTVI-MDAPAAENGGNCKCGPSCACVDCKC 64          
BLAST of CX300208 vs. ExPASy Swiss-Prot
Match: MT3_MALDO (Metallothionein-like protein type 3 OS=Malus domestica GN=MT2 PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.309e-16
Identity = 39/66 (59.09%), Postives = 46/66 (69.70%), Query Frame = 1
Query:   64 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 261
            MS  C NCDCAD +QCVKKG+SY    VET+   + TV V D  AAE +G CKCG  C+CV+CTCG
Sbjct:    1 MSGKCDNCDCADSTQCVKKGNSYDLVIVETENRSMDTVFV-DAPAAEHDGKCKCGTGCSCVSCTCG 65          
BLAST of CX300208 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSJ (Metallothionein-like protein 3A OS=Oryza sativa subsp. japonica GN=MT3A PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 4.976e-16
Identity = 36/66 (54.55%), Postives = 43/66 (65.15%), Query Frame = 1
Query:   64 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 261
            MSD CGNCDCAD+SQCVKKG+SY    VE + S        +V A E  G CKCG +C+C +C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of CX300208 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSI (Metallothionein-like protein 3A OS=Oryza sativa subsp. indica GN=MT3A PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 4.976e-16
Identity = 36/66 (54.55%), Postives = 43/66 (65.15%), Query Frame = 1
Query:   64 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 261
            MSD CGNCDCAD+SQCVKKG+SY    VE + S        +V A E  G CKCG +C+C +C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of CX300208 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSJ (Metallothionein-like protein 3B OS=Oryza sativa subsp. japonica GN=MT3B PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.657e-14
Identity = 33/66 (50.00%), Postives = 41/66 (62.12%), Query Frame = 1
Query:   64 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 261
            MSD CGNCDCAD+SQCVKKG+SY    V+ + S     +  +V   E +G CKC   C+C  C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
BLAST of CX300208 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSI (Metallothionein-like protein 3B OS=Oryza sativa subsp. indica GN=MT3B PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.770e-13
Identity = 32/66 (48.48%), Postives = 41/66 (62.12%), Query Frame = 1
Query:   64 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 261
            MSD CG+CDCAD+SQCVKKG+SY    V+ + S     +  +V   E +G CKC   C+C  C CG
Sbjct:    1 MSDKCGHCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
The following BLAST results are available for this feature:
BLAST of CX300208 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
MT3_CARPA4.964e-2469.70Metallothionein-like protein type 3 OS=Carica papa... [more]
MT3_MUSAC3.682e-1960.94Metallothionein-like protein type 3 OS=Musa acumin... [more]
MT3_ACTDE4.808e-1967.69Metallothionein-like protein type 3 OS=Actinidia d... [more]
MT3_PRUAV7.677e-1758.46Metallothionein-like protein 1 OS=Prunus avium GN=... [more]
MT3_MALDO1.309e-1659.09Metallothionein-like protein type 3 OS=Malus domes... [more]
MT3A_ORYSJ4.976e-1654.55Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3A_ORYSI4.976e-1654.55Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3B_ORYSJ4.657e-1450.00Metallothionein-like protein 3B OS=Oryza sativa su... [more]
MT3B_ORYSI1.770e-1348.48Metallothionein-like protein 3B OS=Oryza sativa su... [more]
back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07007D12SK SaltLeaf1 Citrus clementina cDNA clone C07007D12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX300208 ID=CX300208|Name=CX300208|organism=Citrus clementina|type=EST|length=437bp
GTTTCGTACAATAAAGAGCCCTCTATTTCCAGTTTTAAGTTCCAAGTTCT
AAGCTCAATCAACATGTCGGACACCTGCGGCAACTGCGACTGCGCTGACA
GGAGCCAGTGTGTGAAGAAGGGAAGCAGCTATGCTGCTGACTTCGTCGAG
ACTGACTTGAGCTTTGTCAGCACCGTTGTTGTCATGGACGTTCAGGCTGC
TGAGACTGAAGGTAACTGCAAGTGCGGCCCCACCTGCGCTTGTGTGAACT
GCACTTGTGGTAGTCACTAATAAGCAAACACATGCAGCAAAAAATAAGAA
GCTGCAAGTGTGCCTAAATATTGTGGGGGTTAAGAATAATGTAAGGGTGA
TTAAAAAAAAGAAAAATTCTCTACTTCGTTTTTATGATGGTCTACTACTA
GTGTGTGGAGTGATGTGCGTGTTGTGTCACCCATCAC
back to top