CX300210

Overview
NameCX300210
Unique NameCX300210
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length432
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig3620 contig Ccv1_Contig3620:3..434. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX300210 vs. ExPASy Swiss-Prot
Match: RLA2_PARAR (60S acidic ribosomal protein P2 OS=Parthenium argentatum PE=3 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.494e-20
Identity = 54/112 (48.21%), Postives = 67/112 (59.82%), Query Frame = 2
Query:   44 MKVIAAYLLAVLGGNAKPSADDLKNILGSVGAEADDERIEFLLSEVKGKDITELIASGREKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDDMGFSLFD 379
            MKVIAA+LLA+LGGN  P+ +DLK+IL SVGA+ADD++IE LLS+VKGKDITELIASGRE+L                                        D+++GFSLFD
Sbjct:    1 MKVIAAFLLALLGGNTSPTDEDLKSILASVGADADDDKIELLLSQVKGKDITELIASGRERLASVPSGGGVAVAAAAGGGGGDAPAAAAEEPKKEEKSEEESDEELGFSLFD 112          
BLAST of CX300210 vs. ExPASy Swiss-Prot
Match: RLA2B_MAIZE (60S acidic ribosomal protein P2B OS=Zea mays GN=RPP2B PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 4.255e-20
Identity = 47/62 (75.81%), Postives = 58/62 (93.55%), Query Frame = 2
Query:   44 MKVIAAYLLAVLGGNAKPSADDLKNILGSVGAEADDERIEFLLSEVKGKDITELIASGREKL 229
            MKVIAAYLLAVLGGN  P+ADD+K+IL SVGAEAD+E++EFLL+E+K KDITE+IA+GRE+L
Sbjct:    1 MKVIAAYLLAVLGGNTSPTADDVKSILESVGAEADEEKLEFLLTELKDKDITEVIAAGRERL 62          
BLAST of CX300210 vs. ExPASy Swiss-Prot
Match: RLA2A_MAIZE (60S acidic ribosomal protein P2A OS=Zea mays GN=RPP2A PE=1 SV=3)

HSP 1 Score: 93.5893 bits (231), Expect = 3.602e-19
Identity = 54/112 (48.21%), Postives = 61/112 (54.46%), Query Frame = 2
Query:   44 MKVIAAYLLAVLGGNAKPSADDLKNILGSVGAEADDERIEFLLSEVKGKDITELIASGREKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDDMGFSLFD 379
            MK +AAYLLAVL GNA PSADDL  IL SVG E D+E++E LLS++ GKDITELIA+GREK                                         DDDMGFSLFD
Sbjct:    1 MKFVAAYLLAVLAGNASPSADDLTAILESVGCEVDNEKMELLLSQLSGKDITELIAAGREKFASVPCGGGGVAVAAAAPAAGGAAPAAEAKKEEKVEEKEESDDDMGFSLFD 112          
BLAST of CX300210 vs. ExPASy Swiss-Prot
Match: RLA24_ARATH (60S acidic ribosomal protein P2-4 OS=Arabidopsis thaliana GN=RPP2D PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.048e-18
Identity = 46/62 (74.19%), Postives = 53/62 (85.48%), Query Frame = 2
Query:   44 MKVIAAYLLAVLGGNAKPSADDLKNILGSVGAEADDERIEFLLSEVKGKDITELIASGREKL 229
            MKV AA+LLAVLGGNA PSAD++K+I+G+VGA+ D E IE LL EV GKDI ELIASGREKL
Sbjct:    1 MKVAAAFLLAVLGGNANPSADNIKDIIGAVGADVDGESIELLLKEVSGKDIAELIASGREKL 62          
BLAST of CX300210 vs. ExPASy Swiss-Prot
Match: RLA22_ARATH (60S acidic ribosomal protein P2-2 OS=Arabidopsis thaliana GN=RPP2B PE=1 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 5.201e-18
Identity = 44/62 (70.97%), Postives = 52/62 (83.87%), Query Frame = 2
Query:   44 MKVIAAYLLAVLGGNAKPSADDLKNILGSVGAEADDERIEFLLSEVKGKDITELIASGREKL 229
            MKV+AAYLLAVL G A P++ D+K ILGSVGAE +D +IE LL EVKGKD+ ELIA+GREKL
Sbjct:    1 MKVVAAYLLAVLSGKASPTSADIKTILGSVGAETEDSQIELLLKEVKGKDLAELIAAGREKL 62          
BLAST of CX300210 vs. ExPASy Swiss-Prot
Match: RLA21_ARATH (60S acidic ribosomal protein P2-1 OS=Arabidopsis thaliana GN=RPP2A PE=2 SV=2)

HSP 1 Score: 88.5817 bits (218), Expect = 1.159e-17
Identity = 43/62 (69.35%), Postives = 52/62 (83.87%), Query Frame = 2
Query:   44 MKVIAAYLLAVLGGNAKPSADDLKNILGSVGAEADDERIEFLLSEVKGKDITELIASGREKL 229
            MKV+AA+LLAVL G A P+  D+K+ILGSVGAE +D +IE LL EVKGKD+ ELIA+GREKL
Sbjct:    1 MKVVAAFLLAVLSGKASPTTGDIKDILGSVGAETEDSQIELLLKEVKGKDLAELIAAGREKL 62          
BLAST of CX300210 vs. ExPASy Swiss-Prot
Match: RLA2_BRAFL (60S acidic ribosomal protein P2 OS=Branchiostoma floridae PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.185e-16
Identity = 40/62 (64.52%), Postives = 52/62 (83.87%), Query Frame = 2
Query:   44 MKVIAAYLLAVLGGNAKPSADDLKNILGSVGAEADDERIEFLLSEVKGKDITELIASGREKL 229
            M+ +AAYLLAVLGGNA PSA D+K ILGSVG +A+DER+  ++ E+KGKDI E++A+GR KL
Sbjct:    1 MRYVAAYLLAVLGGNANPSAGDIKKILGSVGIDAEDERLNKVIGELKGKDIEEVMAAGRGKL 62          
BLAST of CX300210 vs. ExPASy Swiss-Prot
Match: RLA23_ARATH (60S acidic ribosomal protein P2-3 OS=Arabidopsis thaliana GN=RPP2C PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 7.029e-15
Identity = 39/62 (62.90%), Postives = 50/62 (80.65%), Query Frame = 2
Query:   44 MKVIAAYLLAVLGGNAKPSADDLKNILGSVGAEADDERIEFLLSEVKGKDITELIASGREKL 229
            MKVIAA+LLA LGGN  P+++DLK IL SVGAE D+ +I+ L S +K  D+TELIA+GREK+
Sbjct:    1 MKVIAAFLLAKLGGNENPTSNDLKKILESVGAEIDETKIDLLFSLIKDHDVTELIAAGREKM 62          
BLAST of CX300210 vs. ExPASy Swiss-Prot
Match: RLA2_ALTAL (60S acidic ribosomal protein P2 OS=Alternaria alternata GN=ALTA5 PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.199e-14
Identity = 40/62 (64.52%), Postives = 49/62 (79.03%), Query Frame = 2
Query:   44 MKVIAAYLLAVLGGNAKPSADDLKNILGSVGAEADDERIEFLLSEVKGKDITELIASGREKL 229
            MK +AAYLL  LGGN  PSA D+K +L SVG EAD +R++ L+SE++GKDI ELIASG EKL
Sbjct:    1 MKHLAAYLLLGLGGNTSPSAADVKAVLESVGIEADSDRLDKLISELEGKDINELIASGSEKL 62          
BLAST of CX300210 vs. ExPASy Swiss-Prot
Match: RLA2_CLAHE (60S acidic ribosomal protein P2 OS=Cladosporium herbarum GN=CLAH5 PE=1 SV=3)

HSP 1 Score: 77.7962 bits (190), Expect = 2.045e-14
Identity = 37/62 (59.68%), Postives = 49/62 (79.03%), Query Frame = 2
Query:   44 MKVIAAYLLAVLGGNAKPSADDLKNILGSVGAEADDERIEFLLSEVKGKDITELIASGREKL 229
            MK +AA+LL  L GN+ PSA+D+K +L SVG +AD+ER+  LL E++GKDI ELI+SG EKL
Sbjct:    1 MKYLAAFLLLGLAGNSSPSAEDIKTVLSSVGIDADEERLSSLLKELEGKDINELISSGSEKL 62          
The following BLAST results are available for this feature:
BLAST of CX300210 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 31
Match NameE-valueIdentityDescription
RLA2_PARAR2.494e-2048.2160S acidic ribosomal protein P2 OS=Parthenium arge... [more]
RLA2B_MAIZE4.255e-2075.8160S acidic ribosomal protein P2B OS=Zea mays GN=RP... [more]
RLA2A_MAIZE3.602e-1948.2160S acidic ribosomal protein P2A OS=Zea mays GN=RP... [more]
RLA24_ARATH1.048e-1874.1960S acidic ribosomal protein P2-4 OS=Arabidopsis t... [more]
RLA22_ARATH5.201e-1870.9760S acidic ribosomal protein P2-2 OS=Arabidopsis t... [more]
RLA21_ARATH1.159e-1769.3560S acidic ribosomal protein P2-1 OS=Arabidopsis t... [more]
RLA2_BRAFL2.185e-1664.5260S acidic ribosomal protein P2 OS=Branchiostoma f... [more]
RLA23_ARATH7.029e-1562.9060S acidic ribosomal protein P2-3 OS=Arabidopsis t... [more]
RLA2_ALTAL1.199e-1464.5260S acidic ribosomal protein P2 OS=Alternaria alte... [more]
RLA2_CLAHE2.045e-1459.6860S acidic ribosomal protein P2 OS=Cladosporium he... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07007E03SK SaltLeaf1 Citrus clementina cDNA clone C07007E03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX300210 ID=CX300210|Name=CX300210|organism=Citrus clementina|type=EST|length=432bp
AAAAGTCGATCTTTATCGTCTCACCTCTCTGCTATAAGCAAAAATGAAGG
TGATCGCTGCTTACTTGCTCGCCGTTTTGGGTGGCAACGCCAAACCATCG
GCCGATGACTTGAAGAACATTCTTGGATCAGTTGGAGCTGAAGCTGATGA
TGAGAGAATAGAGTTTCTCTTGTCAGAAGTCAAGGGCAAGGATATTACCG
AGCTAATTGCATCCGGAAGGGAGAAGTTGGCATCAGTGCCATCAGGTGGT
GGTGTTGCTGTTGCTGCATCAGCACCTGCTGCAGGTGGTGCTGCTGCTCC
TGCCGCTGAGGCTAAAAAAGAGGAGAAGGTCGAGGAGAAGGAAGAATCTG
ATGATGACATGGGTTTCAGCCTTTTCGACTAAGCTCTCAATGTTGCTTTT
TCTGTATGAAGGATTATTATATTTGGTCATTA
back to top