CX300215

Overview
NameCX300215
Unique NameCX300215
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length413
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig3057 contig Ccv1_Contig3057:261..673. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX300215 vs. ExPASy Swiss-Prot
Match: PSAD_CUCSA (Photosystem I reaction center subunit II, chloroplastic OS=Cucumis sativus GN=psaD PE=1 SV=1)

HSP 1 Score: 276.944 bits (707), Expect = 2.141e-74
Identity = 132/136 (97.06%), Postives = 135/136 (99.26%), Query Frame = 2
Query:    5 GFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVGQNYRSIGKNVSPIEVKFT 412
            GF+PPELDP+TPSPIF GSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVGQN+RSIGKNVSPIEVKFT
Sbjct:   65 GFSPPELDPSTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVGQNFRSIGKNVSPIEVKFT 200          
BLAST of CX300215 vs. ExPASy Swiss-Prot
Match: PSAD_SPIOL (Photosystem I reaction center subunit II, chloroplastic OS=Spinacia oleracea GN=psaD PE=1 SV=2)

HSP 1 Score: 273.092 bits (697), Expect = 3.092e-73
Identity = 131/136 (96.32%), Postives = 133/136 (97.79%), Query Frame = 2
Query:    5 GFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVGQNYRSIGKNVSPIEVKFT 412
            GFTPPELDPNTPSPIF GSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFP+GEVQYLHPKDGVYPEKVNPGR+GVG N RSIGKNVSPIEVKFT
Sbjct:   70 GFTPPELDPNTPSPIFAGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPSGEVQYLHPKDGVYPEKVNPGRQGVGLNMRSIGKNVSPIEVKFT 205          
BLAST of CX300215 vs. ExPASy Swiss-Prot
Match: PSAD_SOLLC (Photosystem I reaction center subunit II, chloroplastic OS=Solanum lycopersicum GN=psaD PE=2 SV=1)

HSP 1 Score: 273.092 bits (697), Expect = 3.092e-73
Identity = 130/136 (95.59%), Postives = 133/136 (97.79%), Query Frame = 2
Query:    5 GFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVGQNYRSIGKNVSPIEVKFT 412
            GFTPP+LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMR+GPNLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVGQN+RSIGKN S IEVKFT
Sbjct:   66 GFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMRQGPNLLKLARKEQCLALGTRLRSKYKINYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVGQNFRSIGKNKSAIEVKFT 201          
BLAST of CX300215 vs. ExPASy Swiss-Prot
Match: PSAD2_ARATH (Photosystem I reaction center subunit II-2, chloroplastic OS=Arabidopsis thaliana GN=psaD2 PE=1 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 1.535e-72
Identity = 130/137 (94.89%), Postives = 131/137 (95.62%), Query Frame = 2
Query:    2 VGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVGQNYRSIGKNVSPIEVKFT 412
            VGFTPP+LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK NPGREGVG N RSIGKNVSPIEVKFT
Sbjct:   61 VGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVGLNMRSIGKNVSPIEVKFT 197          
BLAST of CX300215 vs. ExPASy Swiss-Prot
Match: PSAD1_ARATH (Photosystem I reaction center subunit II-1, chloroplastic OS=Arabidopsis thaliana GN=psaD1 PE=1 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 1.535e-72
Identity = 130/137 (94.89%), Postives = 131/137 (95.62%), Query Frame = 2
Query:    2 VGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVGQNYRSIGKNVSPIEVKFT 412
            VGFTPP+LDPNTPSPIF GSTGGLLRKAQVEEFYVITW SPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEK NPGREGVG N RSIGKNVSPIEVKFT
Sbjct:   65 VGFTPPQLDPNTPSPIFAGSTGGLLRKAQVEEFYVITWNSPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKITYQFYRVFPNGEVQYLHPKDGVYPEKANPGREGVGLNMRSIGKNVSPIEVKFT 201          
BLAST of CX300215 vs. ExPASy Swiss-Prot
Match: PSAD_NICSY (Photosystem I reaction center subunit II, chloroplastic OS=Nicotiana sylvestris GN=psaD PE=2 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 2.618e-72
Identity = 129/137 (94.16%), Postives = 133/137 (97.08%), Query Frame = 2
Query:    2 VGFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVGQNYRSIGKNVSPIEVKFT 412
            VGFTPP+LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREG NLLKLARKEQCLALGTRLRSKYKI Y+FYRVFPNGEVQYLHPKDGVYPEKVN GR+GVGQN+RSIGKN SPIEVKFT
Sbjct:   61 VGFTPPQLDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGANLLKLARKEQCLALGTRLRSKYKINYRFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVGQNFRSIGKNKSPIEVKFT 197          
BLAST of CX300215 vs. ExPASy Swiss-Prot
Match: PSAD_HORVU (Photosystem I reaction center subunit II, chloroplastic OS=Hordeum vulgare GN=psaD PE=1 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 2.894e-71
Identity = 126/136 (92.65%), Postives = 131/136 (96.32%), Query Frame = 2
Query:    5 GFTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVGQNYRSIGKNVSPIEVKFT 412
            GF PP+LDP+TPSPIFGGSTGGLLRKAQVEEFYVITW SPKEQ+FEMPTGGAAIMREGPNLLKLARKEQCLALG RLRSKYKI YQFYRVFPNGEVQYLHPKDGVYPEKVN GR+GVGQN+RSIGKNVSPIEVKFT
Sbjct:   63 GFVPPQLDPSTPSPIFGGSTGGLLRKAQVEEFYVITWTSPKEQVFEMPTGGAAIMREGPNLLKLARKEQCLALGNRLRSKYKIAYQFYRVFPNGEVQYLHPKDGVYPEKVNAGRQGVGQNFRSIGKNVSPIEVKFT 198          
BLAST of CX300215 vs. ExPASy Swiss-Prot
Match: PSAD_CHLRE (Photosystem I reaction center subunit II, chloroplastic OS=Chlamydomonas reinhardtii GN=psaD PE=1 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 5.859e-56
Identity = 102/135 (75.56%), Postives = 118/135 (87.41%), Query Frame = 2
Query:    8 FTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKIKYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVGQNYRSIGKNVSPIEVKFT 412
            +T P L+P+TPSPIFGGSTGGLLRKAQ EEFYVITWE+ KEQIFEMPTGGAAIMR+GPNLLK  +KEQCLAL T+LR+K+K+   FYRVFP+G+VQYLHP DGVYPEKVN GR G  QN R IG+NV+PI+VKF+
Sbjct:   53 WTVPTLNPDTPSPIFGGSTGGLLRKAQTEEFYVITWEAKKEQIFEMPTGGAAIMRQGPNLLKFGKKEQCLALTTQLRNKFKLTPCFYRVFPDGKVQYLHPADGVYPEKVNAGRVGANQNMRRIGQNVNPIKVKFS 187          
BLAST of CX300215 vs. ExPASy Swiss-Prot
Match: PSAD_CYAPA (Photosystem I reaction center subunit II, cyanelle OS=Cyanophora paradoxa GN=psaD PE=2 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 3.114e-49
Identity = 91/135 (67.41%), Postives = 110/135 (81.48%), Query Frame = 2
Query:    8 FTPPELDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKI-KYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVGQNYRSIGKNVSPIEVKF 409
            F+ P L+ N P+PIFGGSTGGLLRKA+VEEFY ITW    E +FE+PTGGAAIMR G NLL+LARKEQC+ALG +L+ K+KI  Y+ YRV+P+GEVQ+LHPKDGV+PEKVNPGR  VG N R IG+N  P ++KF
Sbjct:   74 FSVPTLNLNAPTPIFGGSTGGLLRKAEVEEFYSITWTGKSETVFELPTGGAAIMRAGENLLRLARKEQCIALGAQLKDKFKITDYKIYRVYPSGEVQFLHPKDGVFPEKVNPGRVAVGSNKRRIGQNPDPAKLKF 208          
BLAST of CX300215 vs. ExPASy Swiss-Prot
Match: PSAD_GUITH (Photosystem I reaction center subunit II OS=Guillardia theta GN=psaD PE=3 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 3.443e-48
Identity = 91/131 (69.47%), Postives = 108/131 (82.44%), Query Frame = 2
Query:   23 LDPNTPSPIFGGSTGGLLRKAQVEEFYVITWESPKEQIFEMPTGGAAIMREGPNLLKLARKEQCLALGTRLRSKYKI-KYQFYRVFPNGEVQYLHPKDGVYPEKVNPGREGVGQNYRSIGKNVSPIEVKFT 412
            L+   PSP F GSTGG LR A+ EE Y ITW SPKEQ+FEMPTGGAAIMR+G NLL LARKEQCLALGT++++ +KI  Y+ YR+FP+GEVQYLHPKDGV+PEKVNPGR GVG    SIGKN++P ++KFT
Sbjct:    5 LNLQIPSPTFEGSTGGWLRAAETEEKYAITWTSPKEQVFEMPTGGAAIMRKGENLLYLARKEQCLALGTQVKTSFKITDYKIYRIFPSGEVQYLHPKDGVFPEKVNPGRIGVGNVSHSIGKNLNPAQIKFT 135          
The following BLAST results are available for this feature:
BLAST of CX300215 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 26
Match NameE-valueIdentityDescription
PSAD_CUCSA2.141e-7497.06Photosystem I reaction center subunit II, chloropl... [more]
PSAD_SPIOL3.092e-7396.32Photosystem I reaction center subunit II, chloropl... [more]
PSAD_SOLLC3.092e-7395.59Photosystem I reaction center subunit II, chloropl... [more]
PSAD2_ARATH1.535e-7294.89Photosystem I reaction center subunit II-2, chloro... [more]
PSAD1_ARATH1.535e-7294.89Photosystem I reaction center subunit II-1, chloro... [more]
PSAD_NICSY2.618e-7294.16Photosystem I reaction center subunit II, chloropl... [more]
PSAD_HORVU2.894e-7192.65Photosystem I reaction center subunit II, chloropl... [more]
PSAD_CHLRE5.859e-5675.56Photosystem I reaction center subunit II, chloropl... [more]
PSAD_CYAPA3.114e-4967.41Photosystem I reaction center subunit II, cyanelle... [more]
PSAD_GUITH3.443e-4869.47Photosystem I reaction center subunit II OS=Guilla... [more]

Pages

back to top
Libraries
Library NameType
SaltLeaf1cdna_library
Properties
Property NameValue
Genbank descriptionC07007E09SK SaltLeaf1 Citrus clementina cDNA clone C07007E09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX300215 ID=CX300215|Name=CX300215|organism=Citrus clementina|type=EST|length=413bp
GGTGGGCTTCACCCCACCAGAACTGGACCCCAACACCCCATCTCCGATCT
TCGGAGGCAGCACCGGCGGGCTGCTGCGGAAGGCTCAGGTGGAAGAGTTT
TATGTGATCACATGGGAGTCTCCTAAGGAGCAAATATTTGAAATGCCCAC
TGGGGGTGCGGCCATTATGAGAGAAGGTCCGAATTTGCTGAAGCTGGCTA
GGAAAGAGCAGTGCTTGGCTCTGGGGACAAGGCTGAGGTCCAAGTACAAG
ATTAAGTACCAGTTTTACCGAGTGTTTCCCAATGGAGAGGTTCAGTATTT
GCATCCCAAGGATGGTGTTTATCCTGAGAAAGTGAACCCCGGAAGGGAAG
GAGTTGGGCAGAATTACAGGTCTATTGGTAAGAATGTGAGTCCTATTGAG
GTCAAGTTTACAG
back to top