CX300537
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX300537 vs. ExPASy Swiss-Prot
Match: ALFC2_ARATH (Probable fructose-bisphosphate aldolase 2, chloroplastic OS=Arabidopsis thaliana GN=FBA2 PE=1 SV=1) HSP 1 Score: 92.8189 bits (229), Expect = 5.746e-19 Identity = 45/49 (91.84%), Postives = 46/49 (93.88%), Query Frame = 2 Query: 2 GGRPENVKAAQDTLLTRAKANSLAQLGKYTGEGESEEAKKGMFVKGYTY 148 GGRPENV AAQ TLL RAKANSLAQLGKYTGEGESEEAK+GMFVKGYTY Sbjct: 350 GGRPENVNAAQTTLLARAKANSLAQLGKYTGEGESEEAKEGMFVKGYTY 398
BLAST of CX300537 vs. ExPASy Swiss-Prot
Match: ALFC1_ARATH (Probable fructose-bisphosphate aldolase 1, chloroplastic OS=Arabidopsis thaliana GN=FBA1 PE=1 SV=2) HSP 1 Score: 90.8929 bits (224), Expect = 2.183e-18 Identity = 44/49 (89.80%), Postives = 46/49 (93.88%), Query Frame = 2 Query: 2 GGRPENVKAAQDTLLTRAKANSLAQLGKYTGEGESEEAKKGMFVKGYTY 148 GG+ ENVKAAQD LL RAKANSLAQLGKYTGEGESEEAK+GMFVKGYTY Sbjct: 351 GGKEENVKAAQDILLARAKANSLAQLGKYTGEGESEEAKEGMFVKGYTY 399
BLAST of CX300537 vs. ExPASy Swiss-Prot
Match: ALFC_ORYSJ (Fructose-bisphosphate aldolase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os11g0171300 PE=1 SV=2) HSP 1 Score: 82.4185 bits (202), Expect = 7.766e-16 Identity = 39/49 (79.59%), Postives = 43/49 (87.76%), Query Frame = 2 Query: 2 GGRPENVKAAQDTLLTRAKANSLAQLGKYTGEGESEEAKKGMFVKGYTY 148 GG+PENVKAAQD LL RAKANSLAQLGKYT +GE+ EAK+GMFVK Y Y Sbjct: 340 GGQPENVKAAQDALLLRAKANSLAQLGKYTSDGEAAEAKEGMFVKNYVY 388
BLAST of CX300537 vs. ExPASy Swiss-Prot
Match: ALFC1_PEA (Fructose-bisphosphate aldolase 1, chloroplastic (Fragment) OS=Pisum sativum PE=1 SV=1) HSP 1 Score: 81.2629 bits (199), Expect = 1.730e-15 Identity = 39/49 (79.59%), Postives = 44/49 (89.80%), Query Frame = 2 Query: 2 GGRPENVKAAQDTLLTRAKANSLAQLGKYTGEGESEEAKKGMFVKGYTY 148 GG PENVKAAQ+ LL RAK+NSLAQLGKY G+GESEEAKK +FVKGY+Y Sbjct: 308 GGLPENVKAAQEALLFRAKSNSLAQLGKYYGDGESEEAKKELFVKGYSY 356
BLAST of CX300537 vs. ExPASy Swiss-Prot
Match: ALFC3_ARATH (Probable fructose-bisphosphate aldolase 3, chloroplastic OS=Arabidopsis thaliana GN=FBA3 PE=1 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 6.574e-15 Identity = 36/48 (75.00%), Postives = 43/48 (89.58%), Query Frame = 2 Query: 5 GRPENVKAAQDTLLTRAKANSLAQLGKYTGEGESEEAKKGMFVKGYTY 148 G+PE ++A+Q LL RAKANSLAQLGKY+ EGE+E+AKKGMFVKGYTY Sbjct: 344 GKPEKIEASQKALLVRAKANSLAQLGKYSAEGENEDAKKGMFVKGYTY 391
BLAST of CX300537 vs. ExPASy Swiss-Prot
Match: ALFC2_PEA (Fructose-bisphosphate aldolase 2, chloroplastic OS=Pisum sativum PE=1 SV=2) HSP 1 Score: 70.4774 bits (171), Expect = 3.054e-12 Identity = 36/49 (73.47%), Postives = 41/49 (83.67%), Query Frame = 2 Query: 2 GGRPENVKAAQDTLLTRAKANSLAQLGKYTGEGESEEAKKGMFVKGYTY 148 GG PENVKAAQ+ LL RAK+NSLAQLGKY G+GESEEAKK +GY+Y Sbjct: 302 GGLPENVKAAQEALLFRAKSNSLAQLGKYIGDGESEEAKKDC-CQGYSY 349 The following BLAST results are available for this feature:
BLAST of CX300537 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 6
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX300537 ID=CX300537; Name=CX300537; organism=Citrus clementina; type=EST; length=360bpback to top |