CX300590
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX300590 vs. ExPASy Swiss-Prot
Match: PSAN_ARATH (Photosystem I reaction center subunit N, chloroplastic OS=Arabidopsis thaliana GN=PSAN PE=1 SV=2) HSP 1 Score: 56.225 bits (134), Expect = 4.281e-17 Identity = 22/34 (64.71%), Postives = 28/34 (82.35%), Query Frame = 3 Query: 48 LPSKRKCHSISDDLELECKGKEKYKCGSNVFWKW 149 L ++K IS+D+ LEC+GK+KYKCGSNVFWKW Sbjct: 138 LAKQKKVPFISEDIALECEGKDKYKCGSNVFWKW 171 HSP 2 Score: 50.8322 bits (120), Expect = 4.281e-17 Identity = 21/21 (100.00%), Postives = 21/21 (100.00%), Query Frame = 2 Query: 11 CKFPENFTGCQDLAKQKKVPF 73 CKFPENFTGCQDLAKQKKVPF Sbjct: 126 CKFPENFTGCQDLAKQKKVPF 146
BLAST of CX300590 vs. ExPASy Swiss-Prot
Match: PSAN_HORVU (Photosystem I reaction center subunit N, chloroplastic OS=Hordeum vulgare GN=PSAN PE=2 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 5.589e-17 Identity = 23/34 (67.65%), Postives = 29/34 (85.29%), Query Frame = 3 Query: 48 LPSKRKCHSISDDLELECKGKEKYKCGSNVFWKW 149 L ++K I+DDLE+EC+GKEK+KCGSNVFWKW Sbjct: 112 LAKQKKVPFITDDLEIECEGKEKFKCGSNVFWKW 145 HSP 2 Score: 48.1358 bits (113), Expect = 5.589e-17 Identity = 20/21 (95.24%), Postives = 20/21 (95.24%), Query Frame = 2 Query: 11 CKFPENFTGCQDLAKQKKVPF 73 CKFP NFTGCQDLAKQKKVPF Sbjct: 100 CKFPYNFTGCQDLAKQKKVPF 120
BLAST of CX300590 vs. ExPASy Swiss-Prot
Match: PSAN_MAIZE (Photosystem I reaction center subunit N, chloroplastic (Fragment) OS=Zea mays GN=PSAN PE=3 SV=1) HSP 1 Score: 59.6918 bits (143), Expect = 7.316e-17 Identity = 24/34 (70.59%), Postives = 29/34 (85.29%), Query Frame = 3 Query: 48 LPSKRKCHSISDDLELECKGKEKYKCGSNVFWKW 149 L ++K ISDDLE+EC+GKEK+KCGSNVFWKW Sbjct: 79 LAKQKKVPFISDDLEIECEGKEKFKCGSNVFWKW 112 HSP 2 Score: 46.595 bits (109), Expect = 7.316e-17 Identity = 19/21 (90.48%), Postives = 20/21 (95.24%), Query Frame = 2 Query: 11 CKFPENFTGCQDLAKQKKVPF 73 C+FP NFTGCQDLAKQKKVPF Sbjct: 67 CQFPYNFTGCQDLAKQKKVPF 87 The following BLAST results are available for this feature:
BLAST of CX300590 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX300590 ID=CX300590; Name=CX300590; organism=Citrus clementina; type=EST; length=272bpback to top |