CX300607
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX300607 vs. ExPASy Swiss-Prot
Match: ENPL_CATRO (Endoplasmin homolog OS=Catharanthus roseus GN=HSP90 PE=2 SV=1) HSP 1 Score: 85.1149 bits (209), Expect = 1.183e-16 Identity = 42/56 (75.00%), Postives = 49/56 (87.50%), Query Frame = 2 Query: 8 QGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDVAKREAESISKRSLRNNA 175 QGR I A AE +SD VDPPKVE+K+GAVPNGLSTDSDVAKREAES+S R+LR++A Sbjct: 22 QGRKIHANAEADSDAPVDPPKVEDKIGAVPNGLSTDSDVAKREAESMSMRNLRSDA 77
BLAST of CX300607 vs. ExPASy Swiss-Prot
Match: ENPL_HORVU (Endoplasmin homolog OS=Hordeum vulgare PE=2 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 2.467e-14 Identity = 36/58 (62.07%), Postives = 49/58 (84.48%), Query Frame = 2 Query: 2 PDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDVAKREAESISKRSLRNNA 175 PD + +Q AE+ SD++ D PKVEEKLGAVP+GLSTDS+V +RE+ESIS+++LRN+A Sbjct: 20 PDPAKKLQVNAEESSDEVGDFPKVEEKLGAVPHGLSTDSEVVQRESESISRKTLRNSA 77
BLAST of CX300607 vs. ExPASy Swiss-Prot
Match: ENPL_ARATH (Endoplasmin homolog OS=Arabidopsis thaliana GN=SHD PE=1 SV=1) HSP 1 Score: 75.8702 bits (185), Expect = 7.177e-14 Identity = 37/58 (63.79%), Postives = 46/58 (79.31%), Query Frame = 2 Query: 2 PDQGRNIQAKAEDESDKLVDPPKVEEKLGAVPNGLSTDSDVAKREAESISKRSLRNNA 175 PDQGR + A AE+ SD + DPPKVEEK+G GLSTDSDV RE+ES+SK++LR+NA Sbjct: 20 PDQGRKLHANAEESSDDVTDPPKVEEKIGG-HGGLSTDSDVVHRESESMSKKTLRSNA 76 The following BLAST results are available for this feature:
BLAST of CX300607 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX300607 ID=CX300607; Name=CX300607; organism=Citrus clementina; type=EST; length=176bpback to top |