CX305094

Overview
NameCX305094
Unique NameCX305094
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length508
Libraries
Library NameType
Drought1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX305094 vs. ExPASy Swiss-Prot
Match: CYSP_PEA (Cysteine proteinase 15A OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 6.143e-42
Identity = 89/140 (63.57%), Postives = 100/140 (71.43%), Query Frame = 1
Query:   88 MDRRIXXXXXXXXXXXXXXXXXXXGDDAMIRQVVPSDGEQSEDHLLNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKRRQLLDPTAVHGVTKFSDLTPSEFRRQFLGLNRRLRLPADAQKAPILPTNDLPTDF 507
            MDRR                     DD +IRQVV ++    EDHLLNAEHHF+ FKSKFSK+YAT+EEHDYRF VFK+NL +AK  Q  DPTA HG+TKFSDLT SEFRRQFLGL +RLRLPA AQKAPILPT +LP DF
Sbjct:    1 MDRRFLFALFLFAAVATAVTDDTNNDDFIIRQVVDNE----EDHLLNAEHHFTSFKSKFSKSYATKEEHDYRFGVFKSNLIKAKLHQNRDPTAEHGITKFSDLTASEFRRQFLGLKKRLRLPAHAQKAPILPTTNLPEDF 136          
BLAST of CX305094 vs. ExPASy Swiss-Prot
Match: RD19A_ARATH (Cysteine proteinase RD19a OS=Arabidopsis thaliana GN=RD19A PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 2.500e-35
Identity = 74/116 (63.79%), Postives = 87/116 (75.00%), Query Frame = 1
Query:  160 GDDAMIRQVVPSDGEQSEDHLLNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKRRQLLDPTAVHGVTKFSDLTPSEFRRQFLGLNRRLRLPADAQKAPILPTNDLPTDF 507
            GDD +IRQVV      +E  +L +E HFSLFK KF K YA+ EEHDYRF VFKANLRRA+R Q LDP+A HGVT+FSDLT SEFR++ LG+    +LP DA KAPILPT +LP DF
Sbjct:   28 GDDLVIRQVVGG----AEPQVLTSEDHFSLFKRKFGKVYASNEEHDYRFSVFKANLRRARRHQKLDPSATHGVTQFSDLTRSEFRKKHLGVRSGFKLPKDANKAPILPTENLPEDF 139          
BLAST of CX305094 vs. ExPASy Swiss-Prot
Match: A494_ARATH (Probable cysteine proteinase A494 OS=Arabidopsis thaliana GN=At2g21430 PE=2 SV=2)

HSP 1 Score: 132.109 bits (331), Expect = 1.420e-30
Identity = 66/115 (57.39%), Postives = 85/115 (73.91%), Query Frame = 1
Query:  163 DDAMIRQVVPSDGEQSEDHLLNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKRRQLLDPTAVHGVTKFSDLTPSEFRRQFLGLNRRLRLPADAQKAPILPTNDLPTDF 507
            +D +IRQVV    +++E  +L++E HF+LFK KF K Y + EEH YRF VFKANL RA R Q +DP+A HGVT+FSDLT SEFRR+ LG+    +LP DA +APILPT +LP +F
Sbjct:   26 EDVLIRQVV----DETEPKVLSSEDHFTLFKKKFGKVYGSIEEHYYRFSVFKANLLRAMRHQKMDPSARHGVTQFSDLTRSEFRRKHLGVKGGFKLPKDANQAPILPTQNLPEEF 136          
BLAST of CX305094 vs. ExPASy Swiss-Prot
Match: CYSP1_MAIZE (Cysteine proteinase 1 OS=Zea mays GN=CCP1 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 2.677e-29
Identity = 68/120 (56.67%), Postives = 81/120 (67.50%), Query Frame = 1
Query:  163 DDAMIRQVVPSDGEQSEDHLLNAEHHFSLFKSKFSKTYATQEEHDYRFRVFKANLRRAKRRQLLDPTAVHGVTKFSDLTPSEFRRQFLGLNRRLR-----LPADAQKAPILPTNDLPTDF 507
            +D +IRQVVP  G    D  LNAE HF  F  +F K+Y   +EH YR  VFK NLRRA+R QLLDP+A HGVTKFSDLTP+EFRR +LGL +  R     L   A +AP+LPT+ LP DF
Sbjct:   24 EDPLIRQVVP--GGDDNDLELNAESHFLSFVQRFGKSYKDADEHAYRLSVFKDNLRRARRHQLLDPSAEHGVTKFSDLTPAEFRRTYLGLRKSRRALLRELGESAHEAPVLPTDGLPDDF 141          
The following BLAST results are available for this feature:
BLAST of CX305094 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
CYSP_PEA6.143e-4263.57Cysteine proteinase 15A OS=Pisum sativum PE=2 SV=1[more]
RD19A_ARATH2.500e-3563.79Cysteine proteinase RD19a OS=Arabidopsis thaliana ... [more]
A494_ARATH1.420e-3057.39Probable cysteine proteinase A494 OS=Arabidopsis t... [more]
CYSP1_MAIZE2.677e-2956.67Cysteine proteinase 1 OS=Zea mays GN=CCP1 PE=2 SV=... [more]
back to top
Properties
Property NameValue
Genbank descriptionC18001A04Rv Drought1 Citrus clementina cDNA clone C18001A04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX305094 ID=CX305094; Name=CX305094; organism=Citrus clementina; type=EST; length=508bp
GCGGGGAACCACAAGTTTCTTCTGTCTTTTTGGAAACATTTCTTATCTGC
TTCATCCTTCTTCGCAGTCCACTGAAACAAATCAAAAATGGACCGCCGTA
TTCTCTCCTCTCTCCTCCTCCTCCTATCTGCTGTGCTCGCGTCCGCCGTA
GCTGTCAGCGGCGACGATGCTATGATCAGACAGGTCGTGCCATCAGACGG
CGAACAATCCGAAGATCATCTTCTGAACGCGGAGCACCACTTCTCCCTCT
TCAAGTCCAAATTCTCCAAGACTTACGCCACTCAGGAGGAGCACGATTAC
CGATTCCGCGTGTTCAAGGCTAACCTCCGCCGAGCAAAGCGACGCCAGCT
CCTGGACCCCACTGCTGTCCACGGTGTCACCAAGTTCTCCGACTTAACGC
CGTCTGAATTCCGCCGTCAGTTCCTTGGCTTGAATAGGCGGCTTCGGCTA
CCAGCTGACGCTCAAAAGGCTCCTATCCTTCCTACCAACGATCTTCCTAC
TGACTTTG
back to top