CX305096

Overview
NameCX305096
Unique NameCX305096
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length379
Libraries
Library NameType
Drought1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX305096 vs. ExPASy Swiss-Prot
Match: ELI_PEA (Early light-induced protein, chloroplastic OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 3.377e-35
Identity = 82/132 (62.12%), Postives = 96/132 (72.73%), Query Frame = 1
Query:    1 LPSLRRNVNLSVRCTAXXXXXXXXXXXX-PTIPKAE---PQPP--KKPRMSTGFSEVFAFSGPAPERINGRLAMIGFVAALGVEISKGQDVFAQLSDGGVAWFLGTSVLLTVASLVPLFKGVSVESKSDGFM 378
            +P+LRRNV+L VR  A             PT P A    PQP   + P+MST FS++ AFSGPAPERINGRLAMIGFVAA+GVEI+KGQ +  QLS GGVAWFLGTSVLL++ASL+P F+GVSVESKS   M
Sbjct:   34 IPTLRRNVSLKVRSMAEGEPKEQSKVAVDPTTPTASTPTPQPAYTRPPKMSTKFSDLMAFSGPAPERINGRLAMIGFVAAMGVEIAKGQGLSEQLSGGGVAWFLGTSVLLSLASLIPFFQGVSVESKSKSIM 165          
BLAST of CX305096 vs. ExPASy Swiss-Prot
Match: DS22_CRAPL (Desiccation stress protein DSP-22, chloroplastic OS=Craterostigma plantagineum GN=DSP-22 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.627e-21
Identity = 55/128 (42.97%), Postives = 82/128 (64.06%), Query Frame = 1
Query:    1 LPSLRRNVNLSVRCTAXXXXXXXXXXXXP--TIPKAEPQPPKKPRMSTGFS-EVFAFSGPAPERINGRLAMIGFVAALGVEISKGQDVFAQLSDGGVAWFLGTSVLLTVASLVPLFKGVSVESKSDGF 375
            LP +RRN   +VR                  T        P +  ++T  + ++F+F G APERINGR AMIGFVAA+GVE++ G+DVF+Q+ +GGV WFL TS +L +A+L+P+++G+S E+K++GF
Sbjct:   38 LPLMRRNAKFTVRSMREDNEKEEQQQQKQQQTHDGGPDLTPNRTEVTTKRTVDLFSFDGLAPERINGRSAMIGFVAAVGVELATGRDVFSQVFNGGVMWFLLTSAVLVLATLIPIYRGLSPEAKNNGF 165          
BLAST of CX305096 vs. ExPASy Swiss-Prot
Match: ELI6_HORVU (Low molecular mass early light-inducible protein HV60, chloroplastic OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.055e-20
Identity = 49/90 (54.44%), Postives = 61/90 (67.78%), Query Frame = 1
Query:  112 PPKKPRMSTGFSEVFAFSGPAPERINGRLAMIGFVAALGVEISKGQDVFAQLSDG-GVAWFLGTSVLLTVASLVPLFKGVSVESKSDGFM 378
            PP KP+ ST   +  AFSGPAPERINGRLAM+GFV AL VE  +G  + +QL  G G AWF  T  +L++ASLVPL +G S E ++   M
Sbjct:   45 PPNKPKASTSIWDAMAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLGSGTGQAWFAYTVAMLSMASLVPLLQGESAEGRAGAIM 134          
BLAST of CX305096 vs. ExPASy Swiss-Prot
Match: ELI9_HORVU (Low molecular mass early light-inducible protein HV90, chloroplastic OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.349e-20
Identity = 49/90 (54.44%), Postives = 61/90 (67.78%), Query Frame = 1
Query:  112 PPKKPRMSTGFSEVFAFSGPAPERINGRLAMIGFVAALGVEISKGQDVFAQLSDG-GVAWFLGTSVLLTVASLVPLFKGVSVESKSDGFM 378
            PP KP+ ST   +  AFSGPAPERINGRLAM+GFV AL VE  +G  + +QL  G G AWF  T  +L++ASLVPL +G S E ++   M
Sbjct:   50 PPNKPKASTSIWDEMAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLGSGTGQAWFAYTVAVLSMASLVPLLQGESAEGRAGAIM 139          
BLAST of CX305096 vs. ExPASy Swiss-Prot
Match: ELI5_HORVU (High molecular mass early light-inducible protein HV58, chloroplastic OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.166e-19
Identity = 52/98 (53.06%), Postives = 67/98 (68.37%), Query Frame = 1
Query:   85 PTIPKAEPQPPKKPRMSTGFSEVFAFSGPAPERINGRLAMIGFVAALGVEISKGQDVFAQLS--DGGVAWFLGTSVLLTVASLVPLFKGVSVESKSDG 372
            PT   A P+P  K + +    +  AFSGPAPERINGRLAM+GFVAAL VE ++G  +  Q+     G+AWFL T+ + +VASL+PL +G SVESKS G
Sbjct:  100 PTTIPAAPKPVTK-KANPSVWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLDQVGMWSSGLAWFLATAGVFSVASLLPLLQGQSVESKSSG 196          
BLAST of CX305096 vs. ExPASy Swiss-Prot
Match: CBR_DUNBA (Carotene biosynthesis-related protein CBR, chloroplastic OS=Dunaliella bardawil GN=CBR PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 2.355e-12
Identity = 44/86 (51.16%), Postives = 51/86 (59.30%), Query Frame = 1
Query:   88 TIPKAEPQPPKKPRMSTG--FSEVFAFSGPAPERINGRLAMIGFVAALGVEISKGQDVFAQLSDGGVAWFLGTSVLLTVASLVPLF 339
            T P + P PP  P        +EV  FSG APE INGRLAM+GFVAALG E+S G+ V  QL D      L T VL + ASL+P F
Sbjct:   47 TPPPSSPSPPPPPPTPAAPTVTEVMGFSG-APEIINGRLAMLGFVAALGAELSTGESVLTQLGDQPTLIAL-TFVLFSAASLIPAF 130          
The following BLAST results are available for this feature:
BLAST of CX305096 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
ELI_PEA3.377e-3562.12Early light-induced protein, chloroplastic OS=Pisu... [more]
DS22_CRAPL1.627e-2142.97Desiccation stress protein DSP-22, chloroplastic O... [more]
ELI6_HORVU1.055e-2054.44Low molecular mass early light-inducible protein H... [more]
ELI9_HORVU2.349e-2054.44Low molecular mass early light-inducible protein H... [more]
ELI5_HORVU1.166e-1953.06High molecular mass early light-inducible protein ... [more]
CBR_DUNBA2.355e-1251.16Carotene biosynthesis-related protein CBR, chlorop... [more]
back to top
Properties
Property NameValue
Genbank descriptionC18001A06Rv Drought1 Citrus clementina cDNA clone C18001A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX305096 ID=CX305096; Name=CX305096; organism=Citrus clementina; type=EST; length=379bp
TTGCCTAGTCTGCGTAGAAATGTCAACTTATCCGTGCGCTGCACGGCAGA
GGATGAGCAGCAGCAGCAGCAGAAAGATGATCAACCAACCATACCGAAAG
CTGAGCCTCAGCCACCAAAGAAGCCGCGGATGAGCACGGGGTTCTCTGAG
GTGTTCGCGTTCAGCGGGCCGGCACCGGAGAGGATAAACGGGAGGCTTGC
GATGATTGGGTTCGTGGCTGCATTGGGGGTGGAGATATCCAAGGGTCAGG
ATGTGTTTGCCCAGTTATCAGACGGTGGGGTTGCCTGGTTCTTGGGGACC
AGCGTCTTGCTCACGGTTGCGTCCCTGGTTCCTTTGTTTAAAGGTGTCAG
CGTGGAGTCTAAATCGGATGGGTTCATGA
back to top