CX305112

Overview
NameCX305112
Unique NameCX305112
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length471
Libraries
Library NameType
Drought1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX305112 vs. ExPASy Swiss-Prot
Match: ASP_THECC (21 kDa seed protein OS=Theobroma cacao GN=ASP PE=2 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 9.584e-25
Identity = 60/134 (44.78%), Postives = 84/134 (62.69%), Query Frame = -2
Query:   75 CPLDVIQLPSDTQNGIKLTLSPYNNST-IVRESTDLNLRFSVLLSGRD-YCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGR-SFEDGVRRLVL 467
            CP  V+Q  SD  NG  +  S  ++   +VR STD+N+ F  +   RD  C+   +W++DNYD ++GKW++TT G+ G PG  TL +WFK+EK G     YK   CPSVC+SC  LC+++GR S +DG  RL L
Sbjct:   69 CPEIVVQRRSDLDNGTPVIFSNADSKDDVVRVSTDVNIEFVPI---RDRLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAGVL--GYKFRFCPSVCDSCTTLCSDIGRHSDDDGQIRLAL 197          
BLAST of CX305112 vs. ExPASy Swiss-Prot
Match: MIRA_RICDU (Miraculin OS=Richadella dulcifica PE=1 SV=3)

HSP 1 Score: 101.293 bits (251), Expect = 2.209e-21
Identity = 53/140 (37.86%), Postives = 79/140 (56.43%), Query Frame = -2
Query:   51 CPLDVIQLPSDTQNGIKLTLSPYN-NSTIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGRSFEDGVRRLVLVRDDEPAF 467
            CP  V+Q   +  +   L   P N    +VR STDLN+ FS  +  R       +W++D YD ++G++F+T GG+ G+PG ET+ +WFK+E+     G YK+V CP+VC SC   C +VG   +   RR + + D   AF
Sbjct:   76 CPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCR--WTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCG-SGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAF 212          
BLAST of CX305112 vs. ExPASy Swiss-Prot
Match: LSPI_CARPA (Latex serine proteinase inhibitor OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.639e-16
Identity = 54/137 (39.42%), Postives = 75/137 (54.74%), Query Frame = -2
Query:   66 CPLDVIQLPSDTQNGIKLTLSPYNN--STIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGRSFED-GVRRLVLVRD 467
            CPL V+Q P D  NG  +  S   N    IV ES DLN++F++ ++    CNE   WKVD +    G W +T GG  G+ G E+  + FK++K G  P +YK   CPS   + +  CNNV   F+   +RRL+L  D
Sbjct:   45 CPLSVVQDPFD--NGEPIIFSAIKNVKDNIVFESVDLNVKFNITIN----CNETTAWKVDRFPGVIG-WTVTLGGEKGYHGFESTHSMFKIKKAG-LPFSYKFHFCPSYPRTRLIPCNNVDIFFDKYRIRRLILTND 173          
BLAST of CX305112 vs. ExPASy Swiss-Prot
Match: DRTI_DELRE (Kunitz-type serine protease inhibitor DrTI OS=Delonix regia PE=1 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 7.876e-11
Identity = 46/145 (31.72%), Postives = 73/145 (50.34%), Query Frame = -2
Query:   36 CPLDVIQLPSDTQNGIKLTLS-PYNNSTIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGRSFEDGVRRLVLVRDDEPAFPVVLI 467
            CP+ +IQ  SD Q G+ +  S P  +   +   T+L + F      +  C E   W +      SG+  +  GG + HP  E +  +FK+EK+G+    YK+V CP   +S    C+++G ++E G R LVL   D+  F VV +
Sbjct:   44 CPMSIIQEQSDLQMGLPVRFSSPEESQGKIYTDTELEIEFVE----KPDCAESSKWVIVK---DSGEARVAIGGSEDHPQGELVRGFFKIEKLGSL--AYKLVFCP---KSSSGSCSDIGINYE-GRRSLVLKSSDDSPFRVVFV 175          
The following BLAST results are available for this feature:
BLAST of CX305112 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
ASP_THECC9.584e-2544.7821 kDa seed protein OS=Theobroma cacao GN=ASP PE=2... [more]
MIRA_RICDU2.209e-2137.86Miraculin OS=Richadella dulcifica PE=1 SV=3[more]
LSPI_CARPA1.639e-1639.42Latex serine proteinase inhibitor OS=Carica papaya... [more]
DRTI_DELRE7.876e-1131.72Kunitz-type serine protease inhibitor DrTI OS=Delo... [more]
back to top
Properties
Property NameValue
Genbank descriptionC18001C01Rv Drought1 Citrus clementina cDNA clone C18001C01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX305112 ID=CX305112; Name=CX305112; organism=Citrus clementina; type=EST; length=471bp
ATTGATTACACAGACGTTGATCTTTCTGTAGCGGGAATTAACACAACAGG
AAATGCCGGCTCATCATCACGAACCAGAACCAGACGTCGAACGCCATCCT
CAAACGAACGGCCAACGTTGTTGCAGAGTTTGACACAAGACTCGCAAACG
GATGGACAATGAACGATTTTGTATGTACCTGGAAAATTTCCAATTTTCTC
AAGCTTAAACCAATTTAGCAAAGTTTCAGCTCCAGGGTGACCATCAAGTC
CCCCGGTTGTTATAAACCATTTGCCTGATGCCGCGTCATAATTATCAACT
TTCCACAACGGTTGTTCGTTACAATAGTCACGTCCAGATAGCAACACTGA
GAATCTCAAGTTGAGATCAGTGGATTCTCGGACAATTGTAGAATTGTTAT
ACGGTGACAGTGTTAATTTGATTCCATTTTGCGTATCAGAAGGTAATTGG
ATAACGTCCAGCGGACAATAT
back to top