CX305163
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX305163 vs. ExPASy Swiss-Prot
Match: RCI2B_ARATH (Hydrophobic protein RCI2B OS=Arabidopsis thaliana GN=RCI2B PE=2 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 4.347e-13 Identity = 30/36 (83.33%), Postives = 35/36 (97.22%), Query Frame = -1 Query: 306 GVFLKFGCKVEFWICLLLTIFGYIPGIIYAVYAITK 413 GVFLKFGCKVEFWICL+LT+FGY+PGI+YA+Y ITK Sbjct: 19 GVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54
BLAST of CX305163 vs. ExPASy Swiss-Prot
Match: LTI6B_ORYSJ (Hydrophobic protein LTI6B OS=Oryza sativa subsp. japonica GN=LTI6B PE=2 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 4.806e-12 Identity = 31/36 (86.11%), Postives = 32/36 (88.89%), Query Frame = -1 Query: 306 GVFLKFGCKVEFWICLLLTIFGYIPGIIYAVYAITK 413 GVFLKFGC EFWICLLLT GYIPGIIYA+YAITK Sbjct: 20 GVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55
BLAST of CX305163 vs. ExPASy Swiss-Prot
Match: LTI6B_ORYSI (Hydrophobic protein LTI6B OS=Oryza sativa subsp. indica GN=LTI6B PE=3 SV=2) HSP 1 Score: 70.0922 bits (170), Expect = 4.806e-12 Identity = 31/36 (86.11%), Postives = 32/36 (88.89%), Query Frame = -1 Query: 306 GVFLKFGCKVEFWICLLLTIFGYIPGIIYAVYAITK 413 GVFLKFGC EFWICLLLT GYIPGIIYA+YAITK Sbjct: 20 GVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55
BLAST of CX305163 vs. ExPASy Swiss-Prot
Match: LTI6A_ORYSJ (Hydrophobic protein LTI6A OS=Oryza sativa subsp. japonica GN=LTI6A PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 8.198e-12 Identity = 29/36 (80.56%), Postives = 32/36 (88.89%), Query Frame = -1 Query: 306 GVFLKFGCKVEFWICLLLTIFGYIPGIIYAVYAITK 413 GVF KFGC +EFWICLLLT FGY+PGIIYAV+ ITK Sbjct: 21 GVFFKFGCGIEFWICLLLTFFGYLPGIIYAVWVITK 56
BLAST of CX305163 vs. ExPASy Swiss-Prot
Match: RCI2A_ARATH (Hydrophobic protein RCI2A OS=Arabidopsis thaliana GN=RCI2A PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 1.071e-11 Identity = 28/36 (77.78%), Postives = 33/36 (91.67%), Query Frame = -1 Query: 306 GVFLKFGCKVEFWICLLLTIFGYIPGIIYAVYAITK 413 GVFL+FGC VEFWICL+LT+ GYIPGIIYA+Y +TK Sbjct: 19 GVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVLTK 54 The following BLAST results are available for this feature:
BLAST of CX305163 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 5
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX305163 ID=CX305163; Name=CX305163; organism=Citrus clementina; type=EST; length=449bpback to top |