CX305200

Overview
NameCX305200
Unique NameCX305200
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length555
Libraries
Library NameType
Drought1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX305200 vs. ExPASy Swiss-Prot
Match: ASP_THECC (21 kDa seed protein OS=Theobroma cacao GN=ASP PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.169e-26
Identity = 60/132 (45.45%), Postives = 84/132 (63.64%), Query Frame = -2
Query:  162 CPLDVIQLPSAIQWGKKLILSPYDNST-IVRESTDLNLRFVGLLSGSKQCNELPLWKVDNYDASSGRWFITTGGLDGHPGAETLLNWFKLEKTNLPGAYKIVHCPSVCESCVKLCSSVGRFSFEDGVRRLVL 554
            CP  V+Q  S +  G  +I S  D+   +VR STD+N+ FV +    + C+   +W++DNYD S+G+W++TT G+ G PG  TL +WFK+EK  + G YK   CPSVC+SC  LCS +GR S +DG  RL L
Sbjct:   69 CPEIVVQRRSDLDNGTPVIFSNADSKDDVVRVSTDVNIEFVPIRD--RLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAGVLG-YKFRFCPSVCDSCTTLCSDIGRHSDDDGQIRLAL 197          
BLAST of CX305200 vs. ExPASy Swiss-Prot
Match: MIRA_RICDU (Miraculin OS=Richadella dulcifica PE=1 SV=3)

HSP 1 Score: 101.293 bits (251), Expect = 3.296e-21
Identity = 53/138 (38.41%), Postives = 79/138 (57.25%), Query Frame = -2
Query:  144 CPLDVIQLPSAIQWGKKLILSPYD-NSTIVRESTDLNLRFVGLLSGSKQCNELPLWKVDNYDASSGRWFITTGGLDGHPGAETLLNWFKLEKTNLPGAYKIVHCPSVCESCVKLCSSVGRFSFEDGVRRLVLVRDDEP 554
            CP  V+Q    +   + L   P +    +VR STDLN+ F   +    +     +W++D YD S+G++F+T GG+ G+PG ET+ +WFK+E+    G YK+V CP+VC SC   C  VG +  + G RRL L   D+P
Sbjct:   76 CPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPC--RWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLAL--SDKP 209          
BLAST of CX305200 vs. ExPASy Swiss-Prot
Match: LSPI_CARPA (Latex serine proteinase inhibitor OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 6.020e-15
Identity = 51/136 (37.50%), Postives = 73/136 (53.68%), Query Frame = -2
Query:  153 CPLDVIQLPSAIQWGKKLILSPYDN--STIVRESTDLNLRFVGLLSGSKQCNELPLWKVDNYDASSGRWFITTGGLDGHPGAETLLNWFKLEKTNLPGAYKIVHCPSVCESCVKLCSSVGRFSFEDGVRRLVLVRD 554
            CPL V+Q P     G+ +I S   N    IV ES DLN++F   ++    CNE   WKVD +    G W +T GG  G+ G E+  + FK++K  LP +YK   CPS   + +  C++V  F  +  +RRL+L  D
Sbjct:   45 CPLSVVQDP--FDNGEPIIFSAIKNVKDNIVFESVDLNVKFNITIN----CNETTAWKVDRFPGVIG-WTVTLGGEKGYHGFESTHSMFKIKKAGLPFSYKFHFCPSYPRTRLIPCNNVDIFFDKYRIRRLILTND 173          
The following BLAST results are available for this feature:
BLAST of CX305200 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
ASP_THECC1.169e-2645.4521 kDa seed protein OS=Theobroma cacao GN=ASP PE=2... [more]
MIRA_RICDU3.296e-2138.41Miraculin OS=Richadella dulcifica PE=1 SV=3[more]
LSPI_CARPA6.020e-1537.50Latex serine proteinase inhibitor OS=Carica papaya... [more]
back to top
Properties
Property NameValue
Genbank descriptionC18002D10Rv Drought1 Citrus clementina cDNA clone C18002D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX305200 ID=CX305200; Name=CX305200; organism=Citrus clementina; type=EST; length=555bp
TTATTCATAATTTTAATCCTAGAGATTAAAGAGCAGCTAGCCTGGTCCGT
TATTTAGAATAATAATACCGCTAGCTGGTTAGGGTACATTGATTACACAG
ACGTCGATCTTTCTCTAGCTGGAATTAACACAACAGGAAAAGCCGGTTCA
TCATCACGAACCAGAACCAGACGTCGAACGCCATCCTCAAACGAAAAGCG
GCCAACGCTGCTGCAGAGTTTGACGCAAGACTCGCAAACAGATGGACAAT
GAACAATTTTGTATGCACCTGGTAGATTAGTTTTCTCAAGCTTAAACCAA
TTTAGCAACGTTTCAGCTCCAGGGTGACCATCAAGTCCCCCGGTTGTTAT
AAACCATCTGCCTGATGAAGCGTCATAGTTATCAACTTTCCACAACGGTA
GCTCGTTACATTGCTTACTTCCAGATAGTAACCCTACGAATCTCAAGTTG
AGATCAGTGGATTCTCTGACAATTGTAGAATTGTCATATGGTGACAGTAT
TAATTTCTTTCCCCATTGGATAGCAGAAGGTAATTGGATAACATCCAACG
GACAG
back to top