CX305204

Overview
NameCX305204
Unique NameCX305204
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length542
Libraries
Library NameType
Drought1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX305204 vs. ExPASy Swiss-Prot
Match: UCP4_HUMAN (Mitochondrial uncoupling protein 4 OS=Homo sapiens GN=SLC25A27 PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.601e-17
Identity = 39/89 (43.82%), Postives = 63/89 (70.79%), Query Frame = -2
Query:  284 SIMSGLSATALSCPADVVKTRMMSAGKEDK---ITYINSYDCLVKTVRTEGLKALWKGFFPTWARLGPWQFVFWVSYEKFRQIAELSSF 541
            S+ SGL A+ L  PADV+K+R+M+  ++ +   + Y +S DCL++ V+ EG  +L+KGF P+W R+ PW  VFW++YEK R+++ +S F
Sbjct:  235 SLCSGLVASILGTPADVIKSRIMNQPRDKQGRGLLYKSSTDCLIQAVQGEGFMSLYKGFLPSWLRMTPWSMVFWLTYEKIREMSGVSPF 323          
BLAST of CX305204 vs. ExPASy Swiss-Prot
Match: KMCP1_XENTR (Kidney mitochondrial carrier protein 1 OS=Xenopus tropicalis GN=slc25a30 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.074e-13
Identity = 35/83 (42.17%), Postives = 52/83 (62.65%), Query Frame = -2
Query:  302 SIMSGLSATALSCPADVVKTRMM---SAGKEDKITYINSYDCLVKTVRTEGLKALWKGFFPTWARLGPWQFVFWVSYEKFRQI 541
            S   GL+    S P DVV+TRMM   S       +Y  + DCL++T + EG  AL+KGF+P W RLGPW  +F+++YE+ +++
Sbjct:  207 SFTCGLAGALASNPVDVVRTRMMNQRSIRNVSNSSYKGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKKL 289          
BLAST of CX305204 vs. ExPASy Swiss-Prot
Match: KMCP1_XENLA (Kidney mitochondrial carrier protein 1 OS=Xenopus laevis GN=slc25a30 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.074e-13
Identity = 35/83 (42.17%), Postives = 52/83 (62.65%), Query Frame = -2
Query:  302 SIMSGLSATALSCPADVVKTRMM---SAGKEDKITYINSYDCLVKTVRTEGLKALWKGFFPTWARLGPWQFVFWVSYEKFRQI 541
            S   GL+    S P DVV+TRMM   S       +Y  + DCL++T + EG  AL+KGF+P W RLGPW  +F+++YE+ +++
Sbjct:  207 SFTCGLAGALASNPVDVVRTRMMNQRSIRDASNSSYKGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKKL 289          
BLAST of CX305204 vs. ExPASy Swiss-Prot
Match: KMCP1_HUMAN (Kidney mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A30 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.393e-13
Identity = 35/83 (42.17%), Postives = 55/83 (66.27%), Query Frame = -2
Query:  302 SIMSGLSATALSCPADVVKTRMMSAG--KEDKIT-YINSYDCLVKTVRTEGLKALWKGFFPTWARLGPWQFVFWVSYEKFRQI 541
            S   GL+    S P DVV+TRMM+    ++ + + Y  + DCL++T + EG  AL+KGF+P W RLGPW  +F+V+YE+ +++
Sbjct:  207 SFTCGLAGALASNPVDVVRTRMMNQRVLRDGRCSGYTGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFVTYEQLKKL 289          
BLAST of CX305204 vs. ExPASy Swiss-Prot
Match: KMCP1_MOUSE (Kidney mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a30 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.187e-12
Identity = 35/83 (42.17%), Postives = 54/83 (65.06%), Query Frame = -2
Query:  302 SIMSGLSATALSCPADVVKTRMMS--AGKEDKIT-YINSYDCLVKTVRTEGLKALWKGFFPTWARLGPWQFVFWVSYEKFRQI 541
            S   GL     S P DVV+TRMM+  A ++ +   Y  + DCL++T + EG  AL+KGF+P W RLGPW  +F+++YE+ +++
Sbjct:  207 SFTCGLVGALASNPVDVVRTRMMNQRALRDGRCAGYKGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFLTYEQLKKL 289          
BLAST of CX305204 vs. ExPASy Swiss-Prot
Match: UCPB_DICDI (Mitochondrial substrate carrier family protein ucpB OS=Dictyostelium discoideum GN=ucpB PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.551e-12
Identity = 34/84 (40.48%), Postives = 53/84 (63.10%), Query Frame = -2
Query:  299 SIMSGLSATALSCPADVVKTRMMSAGKEDK---ITYINSYDCLVKTVRTEGLKALWKGFFPTWARLGPWQFVFWVSYEKFRQIA 541
            SI +GL A+  + P D+VKTR+M+   +     + Y +SYDC  KT ++EG+  L+KGF P W R+GP   V ++ YE  R+++
Sbjct:  206 SIFAGLIASITTSPVDLVKTRIMNQPFDSNGVGLIYKSSYDCFKKTFQSEGISGLYKGFLPNWFRIGPHTIVTFILYEYLRKVS 289          
BLAST of CX305204 vs. ExPASy Swiss-Prot
Match: KMCP1_MACFA (Kidney mitochondrial carrier protein 1 OS=Macaca fascicularis GN=SLC25A30 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.551e-12
Identity = 34/83 (40.96%), Postives = 54/83 (65.06%), Query Frame = -2
Query:  302 SIMSGLSATALSCPADVVKTRMMSAG--KEDKIT-YINSYDCLVKTVRTEGLKALWKGFFPTWARLGPWQFVFWVSYEKFRQI 541
            S   GL+    S P DVV+TRMM+    ++ + + Y  + DCL++T + EG  AL+KGF+P W RLGPW  + +V+YE+ +++
Sbjct:  207 SFTCGLAGALASNPVDVVRTRMMNQRVLQDGRCSGYTGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIILFVTYEQLKKL 289          
BLAST of CX305204 vs. ExPASy Swiss-Prot
Match: KMCP1_RAT (Kidney mitochondrial carrier protein 1 OS=Rattus norvegicus GN=Slc25a30 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.025e-12
Identity = 34/83 (40.96%), Postives = 54/83 (65.06%), Query Frame = -2
Query:  302 SIMSGLSATALSCPADVVKTRMMSAG--KEDKIT-YINSYDCLVKTVRTEGLKALWKGFFPTWARLGPWQFVFWVSYEKFRQI 541
            S   GL     S P DVV+TRMM+    ++ + + Y  + DCL++T + EG  AL+KGF+P W RLGPW  +F+++YE+ +++
Sbjct:  207 SFTCGLVGALASNPVDVVRTRMMNQRDLRDGRCSGYKGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFLTYEQLKKL 289          
BLAST of CX305204 vs. ExPASy Swiss-Prot
Match: UCP5_MOUSE (Brain mitochondrial carrier protein 1 OS=Mus musculus GN=Slc25a14 PE=2 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 2.925e-11
Identity = 34/84 (40.48%), Postives = 51/84 (60.71%), Query Frame = -2
Query:  302 SIMSGLSATALSCPADVVKTRMMS----AGKEDKITYINSYDCLVKTVRTEGLKALWKGFFPTWARLGPWQFVFWVSYEKFRQI 541
            S   GL+    S P DVV+TRMM+     G  D   Y  + D ++K  + EG  AL+KGF+P W RLGPW  +F+++YE+ +++
Sbjct:  242 SFTCGLAGALASNPVDVVRTRMMNQRAIVGHVD--LYKGTLDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRL 323          
BLAST of CX305204 vs. ExPASy Swiss-Prot
Match: UCP5_HUMAN (Brain mitochondrial carrier protein 1 OS=Homo sapiens GN=SLC25A14 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 2.925e-11
Identity = 34/84 (40.48%), Postives = 51/84 (60.71%), Query Frame = -2
Query:  302 SIMSGLSATALSCPADVVKTRMMS----AGKEDKITYINSYDCLVKTVRTEGLKALWKGFFPTWARLGPWQFVFWVSYEKFRQI 541
            S   GL+    S P DVV+TRMM+     G  D   Y  + D ++K  + EG  AL+KGF+P W RLGPW  +F+++YE+ +++
Sbjct:  242 SFTCGLAGALASNPVDVVRTRMMNQRAIVGHVD--LYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRL 323          
The following BLAST results are available for this feature:
BLAST of CX305204 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
UCP4_HUMAN1.601e-1743.82Mitochondrial uncoupling protein 4 OS=Homo sapiens... [more]
KMCP1_XENTR1.074e-1342.17Kidney mitochondrial carrier protein 1 OS=Xenopus ... [more]
KMCP1_XENLA1.074e-1342.17Kidney mitochondrial carrier protein 1 OS=Xenopus ... [more]
KMCP1_HUMAN2.393e-1342.17Kidney mitochondrial carrier protein 1 OS=Homo sap... [more]
KMCP1_MOUSE1.187e-1242.17Kidney mitochondrial carrier protein 1 OS=Mus musc... [more]
UCPB_DICDI1.551e-1240.48Mitochondrial substrate carrier family protein ucp... [more]
KMCP1_MACFA1.551e-1240.96Kidney mitochondrial carrier protein 1 OS=Macaca f... [more]
KMCP1_RAT2.025e-1240.96Kidney mitochondrial carrier protein 1 OS=Rattus n... [more]
UCP5_MOUSE2.925e-1140.48Brain mitochondrial carrier protein 1 OS=Mus muscu... [more]
UCP5_HUMAN2.925e-1140.48Brain mitochondrial carrier protein 1 OS=Homo sapi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC18002E03Rv Drought1 Citrus clementina cDNA clone C18002E03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX305204 ID=CX305204; Name=CX305204; organism=Citrus clementina; type=EST; length=542bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTGCAAAAAGTTGTAGAAGCGACAT
TTTCTTTTCATTCATAAATGAAATCCACACCAAAGATTATTTATCACATA
ATTCTTGCATTGCTCTATTTCACGATAACTTGATCATCATCAAAGGGTAC
ATAAATTTTGAATCAGTCCAACAAAAGTATGAAACTGGTGGAGATGACCT
TAAAACCTGTGTGAAGACTAGAAAAGGCCTGTCGACTATTTTTTGAAGGG
AACAGGCATTGTGAACAAGAAGCAGAATATTCAGAAGGAAGAGAGCTCTG
CAATTTGCCGAAACTTTTCATACGAGACCCAGAAGACGAATTGCCACGGA
CCAAGTCTTGCCCAGGTCGGAAAGAAACCCTTCCACAGTGCTTTCAACCC
TTCAGTTCTAACGGTCTTCACCAGACAATCATATGAATTTATATACGTTA
TCTTGTCTTCCTTGCCAGCGCTCATCATTCTAGTCTTCACCACATCGGCT
GGACAGCTCAAAGCAGTTGCAGAGAGACCTGACATAATAGAT
back to top