CX305210

Overview
NameCX305210
Unique NameCX305210
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length624
Libraries
Library NameType
Drought1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX305210 vs. ExPASy Swiss-Prot
Match: PR4A_TOBAC (Pathogenesis-related protein PR-4A OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 4.645e-52
Identity = 90/114 (78.95%), Postives = 99/114 (86.84%), Query Frame = 1
Query:  133 TYHLYHPEQIGWDLTAASAFCATWDANKPLAWRQKYGWTAFCHSGGPIGQAACGRCLRVTNSGTGAQQIVRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLTVSYEFVNCND 474
            TYHLY+P+ I WDL AASAFCATWDA+KPLAWRQKYGWTAFC   GP GQ +CGRCLRVTN+GTG Q  VRIVDQC+NGGLDLD  VF +LDTNG+GYQQG LTV+YEFVNCND
Sbjct:   34 TYHLYNPQNINWDLRAASAFCATWDADKPLAWRQKYGWTAFCGPAGPRGQDSCGRCLRVTNTGTGTQTTVRIVDQCSNGGLDLDVNVFNQLDTNGVGYQQGHLTVNYEFVNCND 147          
BLAST of CX305210 vs. ExPASy Swiss-Prot
Match: PR4B_TOBAC (Pathogenesis-related protein PR-4B OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 3.011e-51
Identity = 89/114 (78.07%), Postives = 98/114 (85.96%), Query Frame = 1
Query:  133 TYHLYHPEQIGWDLTAASAFCATWDANKPLAWRQKYGWTAFCHSGGPIGQAACGRCLRVTNSGTGAQQIVRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLTVSYEFVNCND 474
            TYHLY+P+ I WDL AASAFCATWDA+KPLAWRQKYGWTAFC   GP GQ +CGRCLRVTN+GTG Q  VRIVDQC+NGGLDLD  VF +LDTNG+GYQQG L V+YEFVNCND
Sbjct:   34 TYHLYNPQNINWDLRAASAFCATWDADKPLAWRQKYGWTAFCGPAGPRGQDSCGRCLRVTNTGTGTQATVRIVDQCSNGGLDLDVNVFNQLDTNGLGYQQGHLIVNYEFVNCND 147          
BLAST of CX305210 vs. ExPASy Swiss-Prot
Match: PRP2_SOLLC (Pathogenesis-related protein P2 OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 9.065e-48
Identity = 81/112 (72.32%), Postives = 94/112 (83.93%), Query Frame = 1
Query:  133 TYHLYHPEQIGWDLTAASAFCATWDANKPLAWRQKYGWTAFCHSGGPIGQAACGRCLRVTNSGTGAQQIVRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLTVSYEFVNC 468
            TYHLY+P+ I WDL  AS +CATWDA+KPL WR++YGWTAFC   GP GQA+CGRCLRVTN+GTG Q+ VRIVDQC NGGLDLD  VF +LDTNG+GYQ+G L V+YEFVNC
Sbjct:   32 TYHLYNPQNINWDLRTASVYCATWDADKPLEWRRRYGWTAFCGPAGPTGQASCGRCLRVTNTGTGTQETVRIVDQCRNGGLDLDVNVFNRLDTNGLGYQRGNLNVNYEFVNC 143          
BLAST of CX305210 vs. ExPASy Swiss-Prot
Match: WIN2_SOLTU (Wound-induced protein WIN2 OS=Solanum tuberosum GN=WIN2 PE=2 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.447e-45
Identity = 77/114 (67.54%), Postives = 95/114 (83.33%), Query Frame = 1
Query:  133 TYHLYHPEQIGWDLTAASAFCATWDANKPLAWRQKYGWTAFCHSGGPIGQAACGRCLRVTNSGTGAQQIVRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLTVSYEFVNCND 474
            TYH+Y+P+ +GWDL A SA+C+TWDANKP AWR KYGWTAFC   GP G+ +CG+CLRVTN+ TGAQ  VRIVDQC+NGGLDLD  VF+++DT+G+G QQG L V+Y+FVNC D
Sbjct:   85 TYHIYNPQNVGWDLNAVSAYCSTWDANKPYAWRSKYGWTAFCGPVGPRGRDSCGKCLRVTNTRTGAQTTVRIVDQCSNGGLDLDINVFQQIDTDGVGNQQGHLIVNYQFVNCGD 198          
BLAST of CX305210 vs. ExPASy Swiss-Prot
Match: WIN1_SOLTU (Wound-induced protein WIN1 OS=Solanum tuberosum GN=WIN1 PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 2.729e-44
Identity = 75/114 (65.79%), Postives = 95/114 (83.33%), Query Frame = 1
Query:  133 TYHLYHPEQIGWDLTAASAFCATWDANKPLAWRQKYGWTAFCHSGGPIGQAACGRCLRVTNSGTGAQQIVRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLTVSYEFVNCND 474
            TYH+Y+P+ +GWDL A SA+C+TWDANKPL+WR+KYGWTAFC   GP G+ +CG+CLRVTN+ TGAQ  VRIVDQC+NGGLDLD  VF+++DT+G G  QG L V+Y+FV+C D
Sbjct:   86 TYHIYNPQNVGWDLNAVSAYCSTWDANKPLSWRKKYGWTAFCGPVGPRGRDSCGKCLRVTNTRTGAQTTVRIVDQCSNGGLDLDVNVFRQIDTDGNGNHQGHLIVNYQFVDCGD 199          
BLAST of CX305210 vs. ExPASy Swiss-Prot
Match: BARW_HORVU (Barwin OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 2.729e-44
Identity = 83/117 (70.94%), Postives = 92/117 (78.63%), Query Frame = 1
Query:  133 TYHLYHPEQIGWDL--TAASAFCATWDANKPLAWRQKYGWTAFCHSGGPIGQAACGRCLRVTNSGTGAQQIVRIVDQCANGGLDLD-EGVFKKLDTNGIGYQQGFLTVSYEFVNCND 474
            TYH Y P Q  WDL   A SA+CATWDA+KPL+WR KYGWTAFC   GP GQAACG+CLRVTN  TGAQ   RIVDQCANGGLDLD + VF K+DTNGIGYQQG L V+Y+FV+C D
Sbjct:    9 TYHYYRPAQNNWDLGAPAVSAYCATWDASKPLSWRSKYGWTAFCGPAGPRGQAACGKCLRVTNPATGAQITARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHLNVNYQFVDCRD 125          
BLAST of CX305210 vs. ExPASy Swiss-Prot
Match: HEVE_HEVBR (Pro-hevein OS=Hevea brasiliensis GN=HEV1 PE=1 SV=2)

HSP 1 Score: 176.792 bits (447), Expect = 7.941e-44
Identity = 75/114 (65.79%), Postives = 95/114 (83.33%), Query Frame = 1
Query:  133 TYHLYHPEQIGWDLTAASAFCATWDANKPLAWRQKYGWTAFCHSGGPIGQAACGRCLRVTNSGTGAQQIVRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLTVSYEFVNCND 474
            TYHLY+ +  GWDL AASA+C+TWDANKP +WR KYGWTAFC   G  GQ++CG+CL VTN+GTGA+  VRIVDQC+NGGLDLD  VF++LDT+G GY++G +TV+Y+FV+C D
Sbjct:   76 TYHLYNSQDHGWDLNAASAYCSTWDANKPYSWRSKYGWTAFCGPVGAHGQSSCGKCLSVTNTGTGAKTTVRIVDQCSNGGLDLDVNVFRQLDTDGKGYERGHITVNYQFVDCGD 189          
BLAST of CX305210 vs. ExPASy Swiss-Prot
Match: WHW2_WHEAT (Wheatwin-2 OS=Triticum aestivum GN=PR4B PE=1 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 2.311e-43
Identity = 82/117 (70.09%), Postives = 91/117 (77.78%), Query Frame = 1
Query:  133 TYHLYHPEQIGWDL--TAASAFCATWDANKPLAWRQKYGWTAFCHSGGPIGQAACGRCLRVTNSGTGAQQIVRIVDQCANGGLDLD-EGVFKKLDTNGIGYQQGFLTVSYEFVNCND 474
            TYH Y P Q  WDL   A SA+CATWDA+KPL+WR KYGWTAFC   G  GQAACG+CLRVTN  TGAQ   RIVDQCANGGLDLD + VF K+DTNGIGYQQG L V+Y+FV+C D
Sbjct:   32 TYHYYRPAQNNWDLGAPAVSAYCATWDASKPLSWRSKYGWTAFCGPAGAHGQAACGKCLRVTNPATGAQITARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHLNVNYQFVDCRD 148          
BLAST of CX305210 vs. ExPASy Swiss-Prot
Match: WHW1_WHEAT (Wheatwin-1 OS=Triticum aestivum GN=PR4A PE=1 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.498e-42
Identity = 80/117 (68.38%), Postives = 91/117 (77.78%), Query Frame = 1
Query:  133 TYHLYHPEQIGWDL--TAASAFCATWDANKPLAWRQKYGWTAFCHSGGPIGQAACGRCLRVTNSGTGAQQIVRIVDQCANGGLDLD-EGVFKKLDTNGIGYQQGFLTVSYEFVNCND 474
            TYH Y P Q  WDL   A SA+CATWDA+KPL+WR KYGWTAFC   G  GQA+CG+CL+VTN  TGAQ   RIVDQCANGGLDLD + VF K+DTNGIGYQQG L V+Y+FV+C D
Sbjct:   30 TYHYYRPAQNNWDLGAPAVSAYCATWDASKPLSWRSKYGWTAFCGPAGAHGQASCGKCLQVTNPATGAQITARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHLNVNYQFVDCRD 146          
BLAST of CX305210 vs. ExPASy Swiss-Prot
Match: HEVL_ARATH (Hevein-like protein OS=Arabidopsis thaliana GN=HEL PE=1 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 7.433e-42
Identity = 73/114 (64.04%), Postives = 88/114 (77.19%), Query Frame = 1
Query:  133 TYHLYHPEQIGWDLTAASAFCATWDANKPLAWRQKYGWTAFCHSGGPIGQAACGRCLRVTNSGTGAQQIVRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLTVSYEFVNCND 474
            TYH Y+P Q  WDL A SA+C+TWDA+KP AWR KYGWTAFC   GP GQA+CG+CLRV N+ T A   VRIVDQC+NGGLDLD  +F ++DT+G GYQQG L V Y+FV+C +
Sbjct:   80 TYHFYNPAQNNWDLRAVSAYCSTWDADKPYAWRSKYGWTAFCGPAGPRGQASCGKCLRVKNTRTNAAVTVRIVDQCSNGGLDLDVAMFNQIDTDGFGYQQGHLIVDYQFVDCGN 193          
The following BLAST results are available for this feature:
BLAST of CX305210 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
PR4A_TOBAC4.645e-5278.95Pathogenesis-related protein PR-4A OS=Nicotiana ta... [more]
PR4B_TOBAC3.011e-5178.07Pathogenesis-related protein PR-4B OS=Nicotiana ta... [more]
PRP2_SOLLC9.065e-4872.32Pathogenesis-related protein P2 OS=Solanum lycoper... [more]
WIN2_SOLTU1.447e-4567.54Wound-induced protein WIN2 OS=Solanum tuberosum GN... [more]
WIN1_SOLTU2.729e-4465.79Wound-induced protein WIN1 OS=Solanum tuberosum GN... [more]
BARW_HORVU2.729e-4470.94Barwin OS=Hordeum vulgare PE=1 SV=1[more]
HEVE_HEVBR7.941e-4465.79Pro-hevein OS=Hevea brasiliensis GN=HEV1 PE=1 SV=2[more]
WHW2_WHEAT2.311e-4370.09Wheatwin-2 OS=Triticum aestivum GN=PR4B PE=1 SV=1[more]
WHW1_WHEAT1.498e-4268.38Wheatwin-1 OS=Triticum aestivum GN=PR4A PE=1 SV=1[more]
HEVL_ARATH7.433e-4264.04Hevein-like protein OS=Arabidopsis thaliana GN=HEL... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC18002E09Rv Drought1 Citrus clementina cDNA clone C18002E09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX305210 ID=CX305210; Name=CX305210; organism=Citrus clementina; type=EST; length=624bp
GCGGGGGCAACGGATAAGTTAAGCTTAGAACATTAAGAGAAAAATATGGG
GAGGTTCGGTCTCTGTGTGATTCTGTCAGTTTGTCTACTGGTGGCAGCTG
CTTCTGCCCAAAGTGCTTCTAATGTGAGAGCCACGTATCATCTCTACCAC
CCTGAGCAAATTGGATGGGACTTGACGGCAGCGAGCGCTTTCTGCGCAAC
ATGGGATGCCAACAAGCCCTTGGCCTGGCGCCAGAAATATGGCTGGACTG
CTTTCTGTCATTCGGGCGGACCCATTGGACAAGCTGCTTGTGGCAGGTGC
TTAAGGGTCACAAACAGTGGTACAGGAGCCCAACAAATTGTGAGAATTGT
TGATCAGTGTGCCAATGGAGGCTTAGATTTGGACGAAGGAGTGTTCAAGA
AATTGGACACCAATGGAATAGGCTATCAACAAGGCTTCCTTACTGTCAGC
TACGAGTTTGTGAACTGCAATGATTAAAGCACCATCTATAATTCCATGAT
CGATCGAAGCTTAATGCTGTAATAGGGTTAATTTATTAATTAATTATCCC
TCTATATACTTAGTTCATAAATAAAAATAAAACTTCTGATGAAGTATCAA
GAAGTGCTCATGGGCACTACAGTT
back to top