CX305213

Overview
NameCX305213
Unique NameCX305213
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length354
Libraries
Library NameType
Drought1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX305213 vs. ExPASy Swiss-Prot
Match: PR4A_TOBAC (Pathogenesis-related protein PR-4A OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 2.423e-17
Identity = 39/50 (78.00%), Postives = 43/50 (86.00%), Query Frame = -1
Query:  205 GAQQIVRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLTVSYEFVNCND 354
            G Q  VRIVDQC+NGGLDLD  VF +LDTNG+GYQQG LTV+YEFVNCND
Sbjct:   98 GTQTTVRIVDQCSNGGLDLDVNVFNQLDTNGVGYQQGHLTVNYEFVNCND 147          
BLAST of CX305213 vs. ExPASy Swiss-Prot
Match: PR4B_TOBAC (Pathogenesis-related protein PR-4B OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.571e-16
Identity = 38/50 (76.00%), Postives = 42/50 (84.00%), Query Frame = -1
Query:  205 GAQQIVRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLTVSYEFVNCND 354
            G Q  VRIVDQC+NGGLDLD  VF +LDTNG+GYQQG L V+YEFVNCND
Sbjct:   98 GTQATVRIVDQCSNGGLDLDVNVFNQLDTNGLGYQQGHLIVNYEFVNCND 147          
BLAST of CX305213 vs. ExPASy Swiss-Prot
Match: PRP2_SOLLC (Pathogenesis-related protein P2 OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 8.619e-15
Identity = 35/48 (72.92%), Postives = 40/48 (83.33%), Query Frame = -1
Query:  211 GAQQIVRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLTVSYEFVNC 354
            G Q+ VRIVDQC NGGLDLD  VF +LDTNG+GYQ+G L V+YEFVNC
Sbjct:   96 GTQETVRIVDQCRNGGLDLDVNVFNRLDTNGLGYQRGNLNVNYEFVNC 143          
BLAST of CX305213 vs. ExPASy Swiss-Prot
Match: WHW2_WHEAT (Wheatwin-2 OS=Triticum aestivum GN=PR4B PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.508e-14
Identity = 37/51 (72.55%), Postives = 42/51 (82.35%), Query Frame = -1
Query:  205 GAQQIVRIVDQCANGGLDLD-EGVFKKLDTNGIGYQQGFLTVSYEFVNCND 354
            GAQ   RIVDQCANGGLDLD + VF K+DTNGIGYQQG L V+Y+FV+C D
Sbjct:   98 GAQITARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHLNVNYQFVDCRD 148          
BLAST of CX305213 vs. ExPASy Swiss-Prot
Match: WHW1_WHEAT (Wheatwin-1 OS=Triticum aestivum GN=PR4A PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.508e-14
Identity = 37/51 (72.55%), Postives = 42/51 (82.35%), Query Frame = -1
Query:  205 GAQQIVRIVDQCANGGLDLD-EGVFKKLDTNGIGYQQGFLTVSYEFVNCND 354
            GAQ   RIVDQCANGGLDLD + VF K+DTNGIGYQQG L V+Y+FV+C D
Sbjct:   96 GAQITARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHLNVNYQFVDCRD 146          
BLAST of CX305213 vs. ExPASy Swiss-Prot
Match: BARW_HORVU (Barwin OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.508e-14
Identity = 37/51 (72.55%), Postives = 42/51 (82.35%), Query Frame = -1
Query:  205 GAQQIVRIVDQCANGGLDLD-EGVFKKLDTNGIGYQQGFLTVSYEFVNCND 354
            GAQ   RIVDQCANGGLDLD + VF K+DTNGIGYQQG L V+Y+FV+C D
Sbjct:   75 GAQITARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHLNVNYQFVDCRD 125          
BLAST of CX305213 vs. ExPASy Swiss-Prot
Match: WIN_SOYBN (Wound-induced protein (Fragment) OS=Glycine max GN=WIN PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 3.275e-14
Identity = 34/50 (68.00%), Postives = 42/50 (84.00%), Query Frame = -1
Query:  205 GAQQIVRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLTVSYEFVNCND 354
            GA  IVRIVDQC+NGGLDLD GVF ++DT+G GYQQG L V+Y+FV+C +
Sbjct:   38 GANTIVRIVDQCSNGGLDLDVGVFNRIDTDGRGYQQGHLIVNYQFVDCGN 87          
BLAST of CX305213 vs. ExPASy Swiss-Prot
Match: WIN2_SOLTU (Wound-induced protein WIN2 OS=Solanum tuberosum GN=WIN2 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 3.275e-14
Identity = 34/50 (68.00%), Postives = 42/50 (84.00%), Query Frame = -1
Query:  205 GAQQIVRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLTVSYEFVNCND 354
            GAQ  VRIVDQC+NGGLDLD  VF+++DT+G+G QQG L V+Y+FVNC D
Sbjct:  149 GAQTTVRIVDQCSNGGLDLDINVFQQIDTDGVGNQQGHLIVNYQFVNCGD 198          
BLAST of CX305213 vs. ExPASy Swiss-Prot
Match: HEVE_HEVBR (Pro-hevein OS=Hevea brasiliensis GN=HEV1 PE=1 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 1.245e-13
Identity = 32/50 (64.00%), Postives = 43/50 (86.00%), Query Frame = -1
Query:  205 GAQQIVRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLTVSYEFVNCND 354
            GA+  VRIVDQC+NGGLDLD  VF++LDT+G GY++G +TV+Y+FV+C D
Sbjct:  140 GAKTTVRIVDQCSNGGLDLDVNVFRQLDTDGKGYERGHITVNYQFVDCGD 189          
BLAST of CX305213 vs. ExPASy Swiss-Prot
Match: WIN1_SOLTU (Wound-induced protein WIN1 OS=Solanum tuberosum GN=WIN1 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.376e-12
Identity = 32/50 (64.00%), Postives = 40/50 (80.00%), Query Frame = -1
Query:  205 GAQQIVRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLTVSYEFVNCND 354
            GAQ  VRIVDQC+NGGLDLD  VF+++DT+G G  QG L V+Y+FV+C D
Sbjct:  150 GAQTTVRIVDQCSNGGLDLDVNVFRQIDTDGNGNHQGHLIVNYQFVDCGD 199          
The following BLAST results are available for this feature:
BLAST of CX305213 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
PR4A_TOBAC2.423e-1778.00Pathogenesis-related protein PR-4A OS=Nicotiana ta... [more]
PR4B_TOBAC1.571e-1676.00Pathogenesis-related protein PR-4B OS=Nicotiana ta... [more]
PRP2_SOLLC8.619e-1572.92Pathogenesis-related protein P2 OS=Solanum lycoper... [more]
WHW2_WHEAT2.508e-1472.55Wheatwin-2 OS=Triticum aestivum GN=PR4B PE=1 SV=1[more]
WHW1_WHEAT2.508e-1472.55Wheatwin-1 OS=Triticum aestivum GN=PR4A PE=1 SV=1[more]
BARW_HORVU2.508e-1472.55Barwin OS=Hordeum vulgare PE=1 SV=1[more]
WIN_SOYBN3.275e-1468.00Wound-induced protein (Fragment) OS=Glycine max GN... [more]
WIN2_SOLTU3.275e-1468.00Wound-induced protein WIN2 OS=Solanum tuberosum GN... [more]
HEVE_HEVBR1.245e-1364.00Pro-hevein OS=Hevea brasiliensis GN=HEV1 PE=1 SV=2[more]
WIN1_SOLTU1.376e-1264.00Wound-induced protein WIN1 OS=Solanum tuberosum GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC18002F01Rv Drought1 Citrus clementina cDNA clone C18002F01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX305213 ID=CX305213; Name=CX305213; organism=Citrus clementina; type=EST; length=354bp
TTTNTTTTTTTTTTTTTTGGGTTTTTTTTATAAAAAAAGGAAACTTTTAT
TACATAACTGTAGTGCCCATGAGCACTTCTTGATACTTCATCAGAAGTTT
TATTTTATTTATGAACTAAGTATATAGAGGGATAATTAATTAATAAATTA
ACCCTATTACAGCATTAAGCTTCGATCGATCATGGAATTATAGATGGTGC
TTTAATCATTGCAGTTCACAAACTCGTAGCTGACAGTAAGGAAGCCTTGT
TGATAGCCTATTCCATTGGTGTCCAATTTCTTGAACACTCCTTCGTCCAA
ATCTAAGCCTCCATTGGCACACTGATCAACAATTCTCACAATTTGTTGGG
CTCC
back to top