CX305269

Overview
NameCX305269
Unique NameCX305269
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length307
Libraries
Library NameType
Drought1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig860 contig Ccv1_Contig860:417..723. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX305269 vs. ExPASy Swiss-Prot
Match: ASP_THECC (21 kDa seed protein OS=Theobroma cacao GN=ASP PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.841e-17
Identity = 40/78 (51.28%), Postives = 54/78 (69.23%), Query Frame = -3
Query:   75 WKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKHCNNVGR-SFEDGVRRLVL 305
            W++DNYD ++GKW++TT G+ G PG  TL +WFK+EK G     YK   CPSVC+SC   C+++GR S +DG  RL L
Sbjct:  122 WRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAGVL--GYKFRFCPSVCDSCTTLCSDIGRHSDDDGQIRLAL 197          
BLAST of CX305269 vs. ExPASy Swiss-Prot
Match: MIRA_RICDU (Miraculin OS=Richadella dulcifica PE=1 SV=3)

HSP 1 Score: 81.2629 bits (199), Expect = 1.723e-15
Identity = 36/85 (42.35%), Postives = 55/85 (64.71%), Query Frame = -3
Query:   51 WKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKHCNNVGRSFEDGVRRLVLVRDDEPAF 305
            W++D YD ++G++F+T GG+ G+PG ET+ +WFK+E+     G YK+V CP+VC SC   C +VG   +   RR + + D   AF
Sbjct:  129 WRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCG-SGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAF 212          
The following BLAST results are available for this feature:
BLAST of CX305269 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
ASP_THECC1.841e-1751.2821 kDa seed protein OS=Theobroma cacao GN=ASP PE=2... [more]
MIRA_RICDU1.723e-1542.35Miraculin OS=Richadella dulcifica PE=1 SV=3[more]
back to top
Properties
Property NameValue
Genbank descriptionC18003D10Rv Drought1 Citrus clementina cDNA clone C18003D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX305269 ID=CX305269; Name=CX305269; organism=Citrus clementina; type=EST; length=307bp
ATTGATTACACAGACGTTGATCTTTCTGTAGGGGGAATTAACACAACAGG
AAATGCCGGCTCATCATCACGAACCAGAACCAGACGTCGAACGCCATCCT
CAAACGAACGGCCAACGTTGTTGCAGTGTTTGACACAAGACTCGCAAACG
GATGGACAATGAACGATTTTGTATGTACCCGGAAAATTTCCAATTTTCTC
AAGCTTAAACCAATTTAGCAAAGTTTCAGCTCCAGGATGACCATCAAGTC
CCCCGGTTGTTATAAACCATTTGCCTGATGCAGCGTCATAATTATCAACT
TTCCACA
back to top