CX305296

Overview
NameCX305296
Unique NameCX305296
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length436
Libraries
Library NameType
Drought1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX305296 vs. ExPASy Swiss-Prot
Match: ASP_THECC (21 kDa seed protein OS=Theobroma cacao GN=ASP PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 1.357e-21
Identity = 51/106 (48.11%), Postives = 71/106 (66.98%), Query Frame = -3
Query:   75 IVRESTDLNLGFSVLLSGRD-YCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGR-SFEDGVRRLVL 386
            +VR STD+N+ F  +   RD  C+   +W++DNYD ++GKW++TT G+ G PG  TL +WFK+EK G     YK   CPSVC+SC  LC+++GR S +DG  RL L
Sbjct:   97 VVRVSTDVNIEFVPI---RDRLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAGVL--GYKFRFCPSVCDSCTTLCSDIGRHSDDDGQIRLAL 197          
BLAST of CX305296 vs. ExPASy Swiss-Prot
Match: MIRA_RICDU (Miraculin OS=Richadella dulcifica PE=1 SV=3)

HSP 1 Score: 94.3597 bits (233), Expect = 2.167e-19
Identity = 46/112 (41.07%), Postives = 69/112 (61.61%), Query Frame = -3
Query:   51 IVRESTDLNLGFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGRSFEDGVRRLVLVRDDEPAF 386
            +VR STDLN+ FS  +  R       +W++D YD ++G++F+T GG+ G+PG ET+ +WFK+E+     G YK+V CP+VC SC   C +VG   +   RR + + D   AF
Sbjct:  104 VVRVSTDLNINFSAFMPCR--WTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCG-SGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAF 212          
BLAST of CX305296 vs. ExPASy Swiss-Prot
Match: LSPI_CARPA (Latex serine proteinase inhibitor OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 3.959e-13
Identity = 47/124 (37.90%), Postives = 66/124 (53.23%), Query Frame = -3
Query:   66 NGIKLTLSPYNN--STIVRESTDLNLGFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGRSFED-GVRRLVLVRD 428
            NG  +  S   N    IV ES DLN+ F++ ++    CNE   WKVD +    G W +T GG  G+ G E+  + FK++K G  P +YK   CPS   + +  CNNV   F+   +RRL+L  D
Sbjct:   56 NGEPIIFSAIKNVKDNIVFESVDLNVKFNITIN----CNETTAWKVDRFPGVIG-WTVTLGGEKGYHGFESTHSMFKIKKAG-LPFSYKFHFCPSYPRTRLIPCNNVDIFFDKYRIRRLILTND 173          
The following BLAST results are available for this feature:
BLAST of CX305296 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
ASP_THECC1.357e-2148.1121 kDa seed protein OS=Theobroma cacao GN=ASP PE=2... [more]
MIRA_RICDU2.167e-1941.07Miraculin OS=Richadella dulcifica PE=1 SV=3[more]
LSPI_CARPA3.959e-1337.90Latex serine proteinase inhibitor OS=Carica papaya... [more]
back to top
Properties
Property NameValue
Genbank descriptionC18003H03Rv Drought1 Citrus clementina cDNA clone C18003H03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX305296 ID=CX305296; Name=CX305296; organism=Citrus clementina; type=EST; length=436bp
ATTGATTACACAGACGTTGATCTTTCTGTAGCGGGAATTAACACAACAGG
AAATGCCGGCTCATCATCACGAACCAGAACCAGACGTCGAACGCCATCCT
CAAACGAACGGCCAACGTTGTTGCAGAGTTTGACACAAGACTCGCAAACG
GATGGACAATGAACGATTTTGTATGTACCTGGAAAATTTCCAATTTTCTC
AAGCTTAAACCAATTTAGCAAAGTTTCAGCTCCAGGGTGACCATCAAGTC
CCCCGGTTGTTATAAACCATTTGCCTGATGCCGCGTCATAATTATCAACT
TTCCACAACGGTTGTTCGTTACAATAGTCACGTCCAGATAGCAACACTGA
GAATCCCAAGTTGAGATCAGTGGATTCTCGGACAATTGTAGAATTGTTAT
ACGGTGACAGAGTTAATTTGATTCCATTTTGCGTAT
back to top