CX305614

Overview
NameCX305614
Unique NameCX305614
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length365
Libraries
Library NameType
Drought1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX305614 vs. ExPASy Swiss-Prot
Match: PR4A_TOBAC (Pathogenesis-related protein PR-4A OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.028e-16
Identity = 38/50 (76.00%), Postives = 42/50 (84.00%), Query Frame = -1
Query:  216 GAQQIVRIVDQCANGGLDLDEGVFKKLATNGIGYQQGFLTVSYEFVNCND 365
            G Q  VRIVDQC+NGGLDLD  VF +L TNG+GYQQG LTV+YEFVNCND
Sbjct:   98 GTQTTVRIVDQCSNGGLDLDVNVFNQLDTNGVGYQQGHLTVNYEFVNCND 147          
BLAST of CX305614 vs. ExPASy Swiss-Prot
Match: PR4B_TOBAC (Pathogenesis-related protein PR-4B OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.315e-15
Identity = 37/50 (74.00%), Postives = 41/50 (82.00%), Query Frame = -1
Query:  216 GAQQIVRIVDQCANGGLDLDEGVFKKLATNGIGYQQGFLTVSYEFVNCND 365
            G Q  VRIVDQC+NGGLDLD  VF +L TNG+GYQQG L V+YEFVNCND
Sbjct:   98 GTQATVRIVDQCSNGGLDLDVNVFNQLDTNGLGYQQGHLIVNYEFVNCND 147          
BLAST of CX305614 vs. ExPASy Swiss-Prot
Match: PRP2_SOLLC (Pathogenesis-related protein P2 OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.214e-14
Identity = 34/48 (70.83%), Postives = 39/48 (81.25%), Query Frame = -1
Query:  222 GAQQIVRIVDQCANGGLDLDEGVFKKLATNGIGYQQGFLTVSYEFVNC 365
            G Q+ VRIVDQC NGGLDLD  VF +L TNG+GYQ+G L V+YEFVNC
Sbjct:   96 GTQETVRIVDQCRNGGLDLDVNVFNRLDTNGLGYQRGNLNVNYEFVNC 143          
BLAST of CX305614 vs. ExPASy Swiss-Prot
Match: WHW2_WHEAT (Wheatwin-2 OS=Triticum aestivum GN=PR4B PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.099e-13
Identity = 36/51 (70.59%), Postives = 41/51 (80.39%), Query Frame = -1
Query:  216 GAQQIVRIVDQCANGGLDLD-EGVFKKLATNGIGYQQGFLTVSYEFVNCND 365
            GAQ   RIVDQCANGGLDLD + VF K+ TNGIGYQQG L V+Y+FV+C D
Sbjct:   98 GAQITARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHLNVNYQFVDCRD 148          
BLAST of CX305614 vs. ExPASy Swiss-Prot
Match: WHW1_WHEAT (Wheatwin-1 OS=Triticum aestivum GN=PR4A PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.099e-13
Identity = 36/51 (70.59%), Postives = 41/51 (80.39%), Query Frame = -1
Query:  216 GAQQIVRIVDQCANGGLDLD-EGVFKKLATNGIGYQQGFLTVSYEFVNCND 365
            GAQ   RIVDQCANGGLDLD + VF K+ TNGIGYQQG L V+Y+FV+C D
Sbjct:   96 GAQITARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHLNVNYQFVDCRD 146          
BLAST of CX305614 vs. ExPASy Swiss-Prot
Match: BARW_HORVU (Barwin OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.099e-13
Identity = 36/51 (70.59%), Postives = 41/51 (80.39%), Query Frame = -1
Query:  216 GAQQIVRIVDQCANGGLDLD-EGVFKKLATNGIGYQQGFLTVSYEFVNCND 365
            GAQ   RIVDQCANGGLDLD + VF K+ TNGIGYQQG L V+Y+FV+C D
Sbjct:   75 GAQITARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHLNVNYQFVDCRD 125          
BLAST of CX305614 vs. ExPASy Swiss-Prot
Match: WIN_SOYBN (Wound-induced protein (Fragment) OS=Glycine max GN=WIN PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 2.741e-13
Identity = 33/50 (66.00%), Postives = 41/50 (82.00%), Query Frame = -1
Query:  216 GAQQIVRIVDQCANGGLDLDEGVFKKLATNGIGYQQGFLTVSYEFVNCND 365
            GA  IVRIVDQC+NGGLDLD GVF ++ T+G GYQQG L V+Y+FV+C +
Sbjct:   38 GANTIVRIVDQCSNGGLDLDVGVFNRIDTDGRGYQQGHLIVNYQFVDCGN 87          
BLAST of CX305614 vs. ExPASy Swiss-Prot
Match: WIN2_SOLTU (Wound-induced protein WIN2 OS=Solanum tuberosum GN=WIN2 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 2.741e-13
Identity = 33/50 (66.00%), Postives = 41/50 (82.00%), Query Frame = -1
Query:  216 GAQQIVRIVDQCANGGLDLDEGVFKKLATNGIGYQQGFLTVSYEFVNCND 365
            GAQ  VRIVDQC+NGGLDLD  VF+++ T+G+G QQG L V+Y+FVNC D
Sbjct:  149 GAQTTVRIVDQCSNGGLDLDINVFQQIDTDGVGNQQGHLIVNYQFVNCGD 198          
BLAST of CX305614 vs. ExPASy Swiss-Prot
Match: HEVE_HEVBR (Pro-hevein OS=Hevea brasiliensis GN=HEV1 PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 7.976e-13
Identity = 33/59 (55.93%), Postives = 48/59 (81.36%), Query Frame = -1
Query:  192 GAQQIVRIVDQCANGGLDLDEGVFKKLATNGIGYQQGFLTVSYEFVNCND-*SPIYNSM 365
            GA+  VRIVDQC+NGGLDLD  VF++L T+G GY++G +TV+Y+FV+C D  +P+++ M
Sbjct:  140 GAKTTVRIVDQCSNGGLDLDVNVFRQLDTDGKGYERGHITVNYQFVDCGDSFNPLFSVM 198          
BLAST of CX305614 vs. ExPASy Swiss-Prot
Match: WIN1_SOLTU (Wound-induced protein WIN1 OS=Solanum tuberosum GN=WIN1 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.152e-11
Identity = 31/50 (62.00%), Postives = 39/50 (78.00%), Query Frame = -1
Query:  216 GAQQIVRIVDQCANGGLDLDEGVFKKLATNGIGYQQGFLTVSYEFVNCND 365
            GAQ  VRIVDQC+NGGLDLD  VF+++ T+G G  QG L V+Y+FV+C D
Sbjct:  150 GAQTTVRIVDQCSNGGLDLDVNVFRQIDTDGNGNHQGHLIVNYQFVDCGD 199          
The following BLAST results are available for this feature:
BLAST of CX305614 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
PR4A_TOBAC2.028e-1676.00Pathogenesis-related protein PR-4A OS=Nicotiana ta... [more]
PR4B_TOBAC1.315e-1574.00Pathogenesis-related protein PR-4B OS=Nicotiana ta... [more]
PRP2_SOLLC7.214e-1470.83Pathogenesis-related protein P2 OS=Solanum lycoper... [more]
WHW2_WHEAT2.099e-1370.59Wheatwin-2 OS=Triticum aestivum GN=PR4B PE=1 SV=1[more]
WHW1_WHEAT2.099e-1370.59Wheatwin-1 OS=Triticum aestivum GN=PR4A PE=1 SV=1[more]
BARW_HORVU2.099e-1370.59Barwin OS=Hordeum vulgare PE=1 SV=1[more]
WIN_SOYBN2.741e-1366.00Wound-induced protein (Fragment) OS=Glycine max GN... [more]
WIN2_SOLTU2.741e-1366.00Wound-induced protein WIN2 OS=Solanum tuberosum GN... [more]
HEVE_HEVBR7.976e-1355.93Pro-hevein OS=Hevea brasiliensis GN=HEV1 PE=1 SV=2[more]
WIN1_SOLTU1.152e-1162.00Wound-induced protein WIN1 OS=Solanum tuberosum GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC18007H08Rv Drought1 Citrus clementina cDNA clone C18007H08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX305614 ID=CX305614; Name=CX305614; organism=Citrus clementina; type=EST; length=365bp
CGAGGGACTTTTTTTTTTTTTTTTTTTTGTTTTTTTTGAGAAAAAAAGAG
GAAACTTTTATTACATAACTGTAGTGCCCATGAGCACTTCTTGATACTTC
ATCAGAAGTTTTATTTTATTTATGAACTAAGTATATAGAGGGATAATTAA
TAAATAAATTAACCCTATTACAGCATTAAGCTTCGATCGATCATGGAATT
ATAGATGGGGCTTTAATCATTGCAGTTCACAAACTCGTAGCTGACAGTAA
GGAAGCCTTGTTGATAGCCTATTCCATTGGTGGCCAATTTCTTGAACACT
CCTTCGTCCAAATCTAAGCCTCCATTGGCACACTGATCAACAATTCTCAC
AATTTGTTGGGCTCC
back to top