CX305767

Overview
NameCX305767
Unique NameCX305767
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length341
Libraries
Library NameType
Drought1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX305767 vs. ExPASy Swiss-Prot
Match: CYTI_VIGUN (Cysteine proteinase inhibitor OS=Vigna unguiculata PE=3 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 2.909e-23
Identity = 52/88 (59.09%), Postives = 64/88 (72.73%), Query Frame = 2
Query:   77 MATVGGVREVEATANNQEIVNLARFAVDEHNKKQNSNLQFXXXXXXXXXXXXGTLYDITLEAVEGGQKKLFEAKVWEKPWMQFKELKE 340
            MA +GG R+V    N+ EI +LARFAV+EHNKKQN+ L+F            GTLY ITLEA +GGQKK++EAKVWEKPW+ FKEL+E
Sbjct:    1 MAALGGNRDVAGNQNSLEIDSLARFAVEEHNKKQNALLEFGRVVSAQQQVVSGTLYTITLEAKDGGQKKVYEAKVWEKPWLNFKELQE 88          
BLAST of CX305767 vs. ExPASy Swiss-Prot
Match: CYT6_ARATH (Cysteine proteinase inhibitor 6 OS=Arabidopsis thaliana GN=CYS6 PE=1 SV=2)

HSP 1 Score: 103.605 bits (257), Expect = 3.216e-22
Identity = 50/88 (56.82%), Postives = 63/88 (71.59%), Query Frame = 2
Query:   77 MATVGGVREVEATANNQEIVNLARFAVDEHNKKQNSNLQFXXXXXXXXXXXXGTLYDITLEAVEGGQKKLFEAKVWEKPWMQFKELKE 340
            MA VGGV +V A  N+ E+ +LARFAVDEHNKK+N+ L+F            GTL+ +TLE +E GQKKL+EAKVW KPW+ FKEL+E
Sbjct:   34 MALVGGVGDVPANQNSGEVESLARFAVDEHNKKENALLEFARVVKAKEQVVAGTLHHLTLEILEAGQKKLYEAKVWVKPWLNFKELQE 121          
BLAST of CX305767 vs. ExPASy Swiss-Prot
Match: CYT3_ARATH (Cysteine proteinase inhibitor 3 OS=Arabidopsis thaliana GN=CYS3 PE=2 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 6.706e-20
Identity = 48/92 (52.17%), Postives = 61/92 (66.30%), Query Frame = 2
Query:   65 TQKTMATVGGVREVEATANNQEIVNLARFAVDEHNKKQNSNLQFXXXXXXXXXXXXGTLYDITLEAVEGGQKKLFEAKVWEKPWMQFKELKE 340
            T+KTM  +GGV ++    N+ EI +LARFA+ EHNK+QN  L+F            GT+Y +TLEA EG Q K FEAKVW KPWM FK+L+E
Sbjct:   29 TEKTMM-LGGVHDLRGNQNSGEIESLARFAIQEHNKQQNKILEFKKIVKAREQVVAGTMYHLTLEAKEGDQTKNFEAKVWVKPWMNFKQLQE 119          
BLAST of CX305767 vs. ExPASy Swiss-Prot
Match: CYT12_ORYSJ (Cysteine proteinase inhibitor 12 OS=Oryza sativa subsp. japonica GN=Os01g0270100 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 4.346e-19
Identity = 46/99 (46.46%), Postives = 64/99 (64.65%), Query Frame = 2
Query:   50 FIIRLTQKTMA--TVGGVREVEATANNQEIVNLARFAVDEHNKKQNSNLQFXXXXXXXXXXXXGTLYDITLEAVEGGQKKLFEAKVWEKPWMQFKELKE 340
            F++      MA   +GG  +  + AN+ E   LARFAVDEHNK++N+ L+F            GTL+ +TLEA+E G+KK++EAKVW KPW+ FKEL+E
Sbjct:   34 FLVGSASLAMAGHVLGGAHDAPSAANSVETDALARFAVDEHNKRENALLEFVRVVEAKEQVVAGTLHHLTLEALEAGRKKVYEAKVWVKPWLDFKELQE 132          
BLAST of CX305767 vs. ExPASy Swiss-Prot
Match: CYT1_ORYSJ (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica GN=Os01g0803200 PE=1 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 2.817e-18
Identity = 47/85 (55.29%), Postives = 55/85 (64.71%), Query Frame = 2
Query:   86 VGGVREVEATANNQEIVNLARFAVDEHNKKQNSNLQFXXXXXXXXXXXXGTLYDITLEAVEGGQKKLFEAKVWEKPWMQFKELKE 340
            +GGV  V    N+  +V+LARFAV EHNKK NS L+F            GTLY  T+E  EG  KKL+EAKVWEKPWM FKEL+E
Sbjct:   47 LGGVEPV-GNENDLHLVDLARFAVTEHNKKANSLLEFEKLVSVKQQVVAGTLYYFTIEVKEGDAKKLYEAKVWEKPWMDFKELQE 130          
BLAST of CX305767 vs. ExPASy Swiss-Prot
Match: CYT1_MAIZE (Cystatin-1 OS=Zea mays GN=RAMDAZC7 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 5.313e-17
Identity = 40/84 (47.62%), Postives = 56/84 (66.67%), Query Frame = 2
Query:   89 GGVREVEATANNQEIVNLARFAVDEHNKKQNSNLQFXXXXXXXXXXXXGTLYDITLEAVEGGQKKLFEAKVWEKPWMQFKELKE 340
            GG+++V A  N+ ++  LARFAV+EHN+K N+ L F            GT+Y +T+E  +G  KKL+EAKVWEKPW  FK+L+E
Sbjct:   42 GGIKDVPANENDLQLQELARFAVNEHNQKANALLGFEKLVKAKTQVVAGTMYYLTIEVKDGEVKKLYEAKVWEKPWENFKQLQE 125          
BLAST of CX305767 vs. ExPASy Swiss-Prot
Match: CYTA_HELAN (Cysteine proteinase inhibitor A OS=Helianthus annuus PE=1 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 2.637e-16
Identity = 42/71 (59.15%), Postives = 47/71 (66.20%), Query Frame = 2
Query:  128 EIVNLARFAVDEHNKKQNSNLQFXXXXXXXXXXXXGTLYDITLEAVEGGQKKLFEAKVWEKPWMQFKELKE 340
            EI  LARFAVDEHNKKQN+ L+F            G +Y ITLEA  GG KK +EAKVW KPW  FKEL+E
Sbjct:    3 EIDELARFAVDEHNKKQNALLEFGKVVNTKEQVVAGKMYYITLEATNGGVKKTYEAKVWVKPWENFKELQE 73          
BLAST of CX305767 vs. ExPASy Swiss-Prot
Match: CYT1_ARATH (Cysteine proteinase inhibitor 1 OS=Arabidopsis thaliana GN=CYS1 PE=1 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 2.232e-15
Identity = 37/90 (41.11%), Postives = 57/90 (63.33%), Query Frame = 2
Query:   68 QKTMATVGGVREVEATANNQEIVNLARFAVDEHNKKQNSNLQFXXXXXXXXXXXXGTLYDITLEAVEGGQKKLFEAKVWEKPWMQFKELK 337
            Q+    VGGVR+++A AN+ ++ +LARFAVDEHNK +N  L++            GT++ +T+E  +G   K++EAKV EK W   K+L+
Sbjct:    4 QQAGTIVGGVRDIDANANDLQVESLARFAVDEHNKNENLTLEYKRLLGAKTQVVAGTMHHLTVEVADGETNKVYEAKVLEKAWENLKQLE 93          
BLAST of CX305767 vs. ExPASy Swiss-Prot
Match: CYT1_HORVU (Cysteine proteinase inhibitor OS=Hordeum vulgare GN=ICY PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.447e-14
Identity = 40/86 (46.51%), Postives = 52/86 (60.47%), Query Frame = 2
Query:   86 VGGVREVEATANNQ-EIVNLARFAVDEHNKKQNSNLQFXXXXXXXXXXXXGTLYDITLEAVEGGQKKLFEAKVWEKPWMQFKELKE 340
            +GGV++  A   N  E + LARFAV EHN K N+ L+F            G ++  T+E  EGG KKL+EAKVWEK W  FK+L+E
Sbjct:   17 LGGVQDAPAGRENDLETIELARFAVAEHNAKANALLEFEKLVKVRQQVVAGCMHYFTIEVKEGGAKKLYEAKVWEKAWENFKQLQE 102          
BLAST of CX305767 vs. ExPASy Swiss-Prot
Match: CYT7_ARATH (Cysteine proteinase inhibitor 7 OS=Arabidopsis thaliana GN=CYS7 PE=2 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 3.223e-14
Identity = 34/72 (47.22%), Postives = 49/72 (68.06%), Query Frame = 2
Query:  125 QEIVNLARFAVDEHNKKQNSNLQFXXXXXXXXXXXXGTLYDITLEAVEGGQKKLFEAKVWEKPWMQFKELKE 340
            +EI ++A FAV EHN+++N+ L+             G LY +TLE +E G+KK++EAKVW KPWM FK+L+E
Sbjct:   59 KEIDDIALFAVQEHNRRENAVLELARVLKATEQVVAGKLYRLTLEVIEAGEKKIYEAKVWVKPWMNFKQLQE 130          
The following BLAST results are available for this feature:
BLAST of CX305767 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
CYTI_VIGUN2.909e-2359.09Cysteine proteinase inhibitor OS=Vigna unguiculata... [more]
CYT6_ARATH3.216e-2256.82Cysteine proteinase inhibitor 6 OS=Arabidopsis tha... [more]
CYT3_ARATH6.706e-2052.17Cysteine proteinase inhibitor 3 OS=Arabidopsis tha... [more]
CYT12_ORYSJ4.346e-1946.46Cysteine proteinase inhibitor 12 OS=Oryza sativa s... [more]
CYT1_ORYSJ2.817e-1855.29Cysteine proteinase inhibitor 1 OS=Oryza sativa su... [more]
CYT1_MAIZE5.313e-1747.62Cystatin-1 OS=Zea mays GN=RAMDAZC7 PE=2 SV=1[more]
CYTA_HELAN2.637e-1659.15Cysteine proteinase inhibitor A OS=Helianthus annu... [more]
CYT1_ARATH2.232e-1541.11Cysteine proteinase inhibitor 1 OS=Arabidopsis tha... [more]
CYT1_HORVU1.447e-1446.51Cysteine proteinase inhibitor OS=Hordeum vulgare G... [more]
CYT7_ARATH3.223e-1447.22Cysteine proteinase inhibitor 7 OS=Arabidopsis tha... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC18010A06Rv Drought1 Citrus clementina cDNA clone C18010A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX305767 ID=CX305767; Name=CX305767; organism=Citrus clementina; type=EST; length=341bp
TCGGGAAGGAAAGTAGAAAAACACAACAACTTAAAACCTTTCTCATCGCT
TTATCATCAGACTTACGCAGAAAACAATGGCTACAGTAGGCGGTGTTCGT
GAGGTTGAAGCAACAGCCAACAATCAGGAGATCGTTAATCTCGCACGCTT
CGCTGTGGATGAGCATAACAAGAAGCAGAATTCAAATCTGCAATTTGTAA
AAGTTGTAAGTGCGAAGCAGCAAGTGGTTTCAGGGACTCTGTACGACATC
ACCTTGGAGGCTGTTGAAGGAGGTCAGAAGAAACTTTTTGAAGCTAAGGT
CTGGGAGAAGCCTTGGATGCAATTCAAGGAGTTGAAAGAAT
back to top