CX305773

Overview
NameCX305773
Unique NameCX305773
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length322
Libraries
Library NameType
Drought1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX305773 vs. ExPASy Swiss-Prot
Match: LOX23_HORVU (Lipoxygenase 2.3, chloroplastic OS=Hordeum vulgare GN=LOX2.3 PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 4.304e-19
Identity = 41/62 (66.13%), Postives = 51/62 (82.26%), Query Frame = -3
Query:  135 WREDPVINAAFEKFRGKLMELEGIIDARNADPKLRNRNGAGMVPYELLKPFSEPGVTGKGVP 320
            W  +P++ AAFEKF G+L E EG ID RN +P+ +NR GAG+VPYELLKPFSEPGVTG+G+P
Sbjct:  830 WLAEPMVKAAFEKFSGRLKEAEGTIDMRNNNPENKNRCGAGIVPYELLKPFSEPGVTGRGIP 891          
BLAST of CX305773 vs. ExPASy Swiss-Prot
Match: LOX2_ARATH (Lipoxygenase 2, chloroplastic OS=Arabidopsis thaliana GN=LOX2 PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.252e-18
Identity = 43/63 (68.25%), Postives = 50/63 (79.37%), Query Frame = -3
Query:  132 WREDPVINAAFEKFRGKLMELEGIIDARNADPKLRNRNGAGMVPYELLKPFSEPGVTGKGVPY 320
            W  +PVINAAFE+F+GKL  LEG+ID RN +  L+NR GAG+V YELLKP SE GVTG GVPY
Sbjct:  830 WANEPVINAAFERFKGKLQYLEGVIDERNVNITLKNRAGAGVVKYELLKPTSEHGVTGMGVPY 892          
BLAST of CX305773 vs. ExPASy Swiss-Prot
Match: LOXC1_ORYSJ (Lipoxygenase 7, chloroplastic OS=Oryza sativa subsp. japonica GN=CM-LOX1 PE=2 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 5.817e-16
Identity = 34/62 (54.84%), Postives = 47/62 (75.81%), Query Frame = -3
Query:  135 WREDPVINAAFEKFRGKLMELEGIIDARNADPKLRNRNGAGMVPYELLKPFSEPGVTGKGVP 320
            W  D  + AA++ F  +L E+EG+ID RN D KL+NR GAG++PY+L+KPFS+ GVTG G+P
Sbjct:  858 WNSDAAVQAAYDGFAARLKEIEGVIDGRNKDRKLKNRCGAGILPYQLMKPFSDSGVTGMGIP 919          
BLAST of CX305773 vs. ExPASy Swiss-Prot
Match: LOXC2_ORYSJ (Probable lipoxygenase 8, chloroplastic OS=Oryza sativa subsp. japonica GN=CM-LOX2 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.296e-15
Identity = 34/62 (54.84%), Postives = 46/62 (74.19%), Query Frame = -3
Query:  135 WREDPVINAAFEKFRGKLMELEGIIDARNADPKLRNRNGAGMVPYELLKPFSEPGVTGKGVP 320
            W  D  + AA+  F  +L E+EG+ID RN D KL+NR GAG++PY+L+KPFS+ GVTG G+P
Sbjct:  875 WNSDAAVQAAYAGFTARLKEIEGVIDGRNKDRKLKNRCGAGILPYQLMKPFSDAGVTGMGIP 936          
BLAST of CX305773 vs. ExPASy Swiss-Prot
Match: LOX6_ARATH (Lipoxygenase 6, choloroplastic OS=Arabidopsis thaliana GN=LOX6 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.483e-11
Identity = 32/62 (51.61%), Postives = 42/62 (67.74%), Query Frame = -3
Query:  135 WREDPVINAAFEKFRGKLMELEGIIDARNADPKLRNRNGAGMVPYELLKPFSEPGVTGKGVP 320
            W +D  +   F KF  +L+++E  I+ RN D KL+NR GAGM PYELL P S  GVTG+G+P
Sbjct:  851 WFQDEQVVKYFNKFSEELVKIEKTINERNKDKKLKNRTGAGMPPYELLLPTSPHGVTGRGIP 912          
BLAST of CX305773 vs. ExPASy Swiss-Prot
Match: LOX3_ARATH (Lipoxygenase 3, chloroplastic OS=Arabidopsis thaliana GN=LOX3 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.303e-11
Identity = 34/62 (54.84%), Postives = 41/62 (66.13%), Query Frame = -3
Query:  135 WREDPVINAAFEKFRGKLMELEGIIDARNADPKLRNRNGAGMVPYELLKPFSEPGVTGKGVP 320
            W  D  I  AF  F  ++  +E  I+ RNADP  RNR GAG++PYELL P SEPGVT +GVP
Sbjct:  853 WTGDAEIVEAFYGFAAEIGRIEKEIEKRNADPDRRNRCGAGVLPYELLVPSSEPGVTCRGVP 914          
BLAST of CX305773 vs. ExPASy Swiss-Prot
Match: LOX4_ARATH (Lipoxygenase 4, chloroplastic OS=Arabidopsis thaliana GN=LOX4 PE=2 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 5.634e-11
Identity = 33/62 (53.23%), Postives = 40/62 (64.52%), Query Frame = -3
Query:  135 WREDPVINAAFEKFRGKLMELEGIIDARNADPKLRNRNGAGMVPYELLKPFSEPGVTGKGVP 320
            W  D  I  AF  F  ++  +E  ID RN DP  RNR GAG++PYEL+ P SEPGVT +GVP
Sbjct:  860 WTGDAEIVDAFYGFSAEIGRIEKEIDKRNRDPSRRNRCGAGVLPYELMAPSSEPGVTCRGVP 921          
BLAST of CX305773 vs. ExPASy Swiss-Prot
Match: LOX5_ORYSJ (Putative lipoxygenase 5 OS=Oryza sativa subsp. japonica GN=Os04g0447100 PE=3 SV=2)

HSP 1 Score: 65.4698 bits (158), Expect = 9.610e-11
Identity = 31/62 (50.00%), Postives = 39/62 (62.90%), Query Frame = -3
Query:  135 WREDPVINAAFEKFRGKLMELEGIIDARNADPKLRNRNGAGMVPYELLKPFSEPGVTGKGVP 320
            W  DP   AA  +F   +   E  I+ RNADP  RNR GAG++PYEL+ P S PG+T +GVP
Sbjct:  833 WTADPAALAAAREFAADVRRAEEEIERRNADPSRRNRCGAGVLPYELMAPSSGPGITCRGVP 894          
The following BLAST results are available for this feature:
BLAST of CX305773 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
LOX23_HORVU4.304e-1966.13Lipoxygenase 2.3, chloroplastic OS=Hordeum vulgare... [more]
LOX2_ARATH1.252e-1868.25Lipoxygenase 2, chloroplastic OS=Arabidopsis thali... [more]
LOXC1_ORYSJ5.817e-1654.84Lipoxygenase 7, chloroplastic OS=Oryza sativa subs... [more]
LOXC2_ORYSJ1.296e-1554.84Probable lipoxygenase 8, chloroplastic OS=Oryza sa... [more]
LOX6_ARATH1.483e-1151.61Lipoxygenase 6, choloroplastic OS=Arabidopsis thal... [more]
LOX3_ARATH3.303e-1154.84Lipoxygenase 3, chloroplastic OS=Arabidopsis thali... [more]
LOX4_ARATH5.634e-1153.23Lipoxygenase 4, chloroplastic OS=Arabidopsis thali... [more]
LOX5_ORYSJ9.610e-1150.00Putative lipoxygenase 5 OS=Oryza sativa subsp. jap... [more]
back to top
Properties
Property NameValue
Genbank descriptionC18010B02Rv Drought1 Citrus clementina cDNA clone C18010B02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX305773 ID=CX305773; Name=CX305773; organism=Citrus clementina; type=EST; length=322bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTGACTGCAATTTATTTGATTCATT
CTTGAACTCATTCTCAAAAGTTTTTATTGACACAACATTCGAGCGATTGC
AACAACATTTTCAACTCTAGATAGAGATGCTGTACGGAACTCCTTTTCCT
GTAACACCAGGTTCCGAAAATGGCTTCAAGAGCTCATATGGCACCATCCC
AGCTCCATTTCTATTCCTCAACTTGGGATCTGCATTCCTTGCATCAATAA
TCCCTTCAAGCTCCATTAACTTGCCTCTAAACTTTTCAAATGCTGCATTT
ATAACCGGATCCTCACGCCATG
back to top