CX305778

Overview
NameCX305778
Unique NameCX305778
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length355
Libraries
Library NameType
Drought1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX305778 vs. ExPASy Swiss-Prot
Match: PRP2_SOLLC (Pathogenesis-related protein P2 OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 1.062e-36
Identity = 59/80 (73.75%), Postives = 68/80 (85.00%), Query Frame = 2
Query:   71 RQKYGWTAFCHSGGPIGQAACGRCLRVTNSGTGAQQIVRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLTVSYEFVNC 310
            R++YGWTAFC   GP GQA+CGRCLRVTN+GTG Q+ VRIVDQC NGGLDLD  VF +LDTNG+GYQ+G L V+YEFVNC
Sbjct:   64 RRRYGWTAFCGPAGPTGQASCGRCLRVTNTGTGTQETVRIVDQCRNGGLDLDVNVFNRLDTNGLGYQRGNLNVNYEFVNC 143          

HSP 2 Score: 38.5058 bits (88), Expect = 1.062e-36
Identity = 15/23 (65.22%), Postives = 17/23 (73.91%), Query Frame = 3
Query:    9 WDLTAASAFCATWDANKPLAGAR 77
            WDL  AS +CATWDA+KPL   R
Sbjct:   43 WDLRTASVYCATWDADKPLEWRR 65          
BLAST of CX305778 vs. ExPASy Swiss-Prot
Match: PR4A_TOBAC (Pathogenesis-related protein PR-4A OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 9.793e-35
Identity = 67/101 (66.34%), Postives = 75/101 (74.26%), Query Frame = 2
Query:   14 LDGSERFLRNMGCQQALGRRQKYGWTAFCHSGGPIGQAACGRCLRVTNSGTGAQQIVRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLTVSYEFVNCND 316
            L  +  F       + L  RQKYGWTAFC   GP GQ +CGRCLRVTN+GTG Q  VRIVDQC+NGGLDLD  VF +LDTNG+GYQQG LTV+YEFVNCND
Sbjct:   47 LRAASAFCATWDADKPLAWRQKYGWTAFCGPAGPRGQDSCGRCLRVTNTGTGTQTTVRIVDQCSNGGLDLDVNVFNQLDTNGVGYQQGHLTVNYEFVNCND 147          
BLAST of CX305778 vs. ExPASy Swiss-Prot
Match: PR4B_TOBAC (Pathogenesis-related protein PR-4B OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 6.347e-34
Identity = 66/101 (65.35%), Postives = 74/101 (73.27%), Query Frame = 2
Query:   14 LDGSERFLRNMGCQQALGRRQKYGWTAFCHSGGPIGQAACGRCLRVTNSGTGAQQIVRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLTVSYEFVNCND 316
            L  +  F       + L  RQKYGWTAFC   GP GQ +CGRCLRVTN+GTG Q  VRIVDQC+NGGLDLD  VF +LDTNG+GYQQG L V+YEFVNCND
Sbjct:   47 LRAASAFCATWDADKPLAWRQKYGWTAFCGPAGPRGQDSCGRCLRVTNTGTGTQATVRIVDQCSNGGLDLDVNVFNQLDTNGLGYQQGHLIVNYEFVNCND 147          
BLAST of CX305778 vs. ExPASy Swiss-Prot
Match: HEVL_ARATH (Hevein-like protein OS=Arabidopsis thaliana GN=HEL PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 1.179e-31
Identity = 52/82 (63.41%), Postives = 63/82 (76.83%), Query Frame = 2
Query:   71 RQKYGWTAFCHSGGPIGQAACGRCLRVTNSGTGAQQIVRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLTVSYEFVNCND 316
            R KYGWTAFC   GP GQA+CG+CLRV N+ T A   VRIVDQC+NGGLDLD  +F ++DT+G GYQQG L V Y+FV+C +
Sbjct:  112 RSKYGWTAFCGPAGPRGQASCGKCLRVKNTRTNAAVTVRIVDQCSNGGLDLDVAMFNQIDTDGFGYQQGHLIVDYQFVDCGN 193          

HSP 2 Score: 38.1206 bits (87), Expect = 1.179e-31
Identity = 14/20 (70.00%), Postives = 17/20 (85.00%), Query Frame = 3
Query:    9 WDLTAASAFCATWDANKPLA 68
            WDL A SA+C+TWDA+KP A
Sbjct:   91 WDLRAVSAYCSTWDADKPYA 110          
BLAST of CX305778 vs. ExPASy Swiss-Prot
Match: BARW_HORVU (Barwin OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 1.120e-30
Identity = 63/104 (60.58%), Postives = 72/104 (69.23%), Query Frame = 2
Query:    8 MGLDGSERFLRNMGCQQALGRRQKYGWTAFCHSGGPIGQAACGRCLRVTNSGTGAQQIVRIVDQCANGGLDLD-EGVFKKLDTNGIGYQQGFLTVSYEFVNCND 316
            +G      +       + L  R KYGWTAFC   GP GQAACG+CLRVTN  TGAQ   RIVDQCANGGLDLD + VF K+DTNGIGYQQG L V+Y+FV+C D
Sbjct:   22 LGAPAVSAYCATWDASKPLSWRSKYGWTAFCGPAGPRGQAACGKCLRVTNPATGAQITARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHLNVNYQFVDCRD 125          
BLAST of CX305778 vs. ExPASy Swiss-Prot
Match: WHW2_WHEAT (Wheatwin-2 OS=Triticum aestivum GN=PR4B PE=1 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 9.485e-30
Identity = 62/104 (59.62%), Postives = 71/104 (68.27%), Query Frame = 2
Query:    8 MGLDGSERFLRNMGCQQALGRRQKYGWTAFCHSGGPIGQAACGRCLRVTNSGTGAQQIVRIVDQCANGGLDLD-EGVFKKLDTNGIGYQQGFLTVSYEFVNCND 316
            +G      +       + L  R KYGWTAFC   G  GQAACG+CLRVTN  TGAQ   RIVDQCANGGLDLD + VF K+DTNGIGYQQG L V+Y+FV+C D
Sbjct:   45 LGAPAVSAYCATWDASKPLSWRSKYGWTAFCGPAGAHGQAACGKCLRVTNPATGAQITARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHLNVNYQFVDCRD 148          
BLAST of CX305778 vs. ExPASy Swiss-Prot
Match: WIN_SOYBN (Wound-induced protein (Fragment) OS=Glycine max GN=WIN PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 2.760e-29
Identity = 56/82 (68.29%), Postives = 68/82 (82.93%), Query Frame = 2
Query:   71 RQKYGWTAFCHSGGPIGQAACGRCLRVTNSGTGAQQIVRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLTVSYEFVNCND 316
            R KYGWTAFC   GP G+ +CG+CLRVTN+GTGA  IVRIVDQC+NGGLDLD GVF ++DT+G GYQQG L V+Y+FV+C +
Sbjct:    6 RSKYGWTAFCGPVGPRGRDSCGKCLRVTNTGTGANTIVRIVDQCSNGGLDLDVGVFNRIDTDGRGYQQGHLIVNYQFVDCGN 87          
BLAST of CX305778 vs. ExPASy Swiss-Prot
Match: WHW1_WHEAT (Wheatwin-1 OS=Triticum aestivum GN=PR4A PE=1 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 6.148e-29
Identity = 60/104 (57.69%), Postives = 71/104 (68.27%), Query Frame = 2
Query:    8 MGLDGSERFLRNMGCQQALGRRQKYGWTAFCHSGGPIGQAACGRCLRVTNSGTGAQQIVRIVDQCANGGLDLD-EGVFKKLDTNGIGYQQGFLTVSYEFVNCND 316
            +G      +       + L  R KYGWTAFC   G  GQA+CG+CL+VTN  TGAQ   RIVDQCANGGLDLD + VF K+DTNGIGYQQG L V+Y+FV+C D
Sbjct:   43 LGAPAVSAYCATWDASKPLSWRSKYGWTAFCGPAGAHGQASCGKCLQVTNPATGAQITARIVDQCANGGLDLDWDTVFTKIDTNGIGYQQGHLNVNYQFVDCRD 146          
BLAST of CX305778 vs. ExPASy Swiss-Prot
Match: WIN2_SOLTU (Wound-induced protein WIN2 OS=Solanum tuberosum GN=WIN2 PE=2 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 1.789e-28
Identity = 57/104 (54.81%), Postives = 72/104 (69.23%), Query Frame = 2
Query:    5 GMGLDGSERFLRNMGCQQALGRRQKYGWTAFCHSGGPIGQAACGRCLRVTNSGTGAQQIVRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLTVSYEFVNCND 316
            G  L+    +       +    R KYGWTAFC   GP G+ +CG+CLRVTN+ TGAQ  VRIVDQC+NGGLDLD  VF+++DT+G+G QQG L V+Y+FVNC D
Sbjct:   95 GWDLNAVSAYCSTWDANKPYAWRSKYGWTAFCGPVGPRGRDSCGKCLRVTNTRTGAQTTVRIVDQCSNGGLDLDINVFQQIDTDGVGNQQGHLIVNYQFVNCGD 198          
BLAST of CX305778 vs. ExPASy Swiss-Prot
Match: HEVE_HEVBR (Pro-hevein OS=Hevea brasiliensis GN=HEV1 PE=1 SV=2)

HSP 1 Score: 124.02 bits (310), Expect = 2.336e-28
Identity = 55/104 (52.88%), Postives = 74/104 (71.15%), Query Frame = 2
Query:    5 GMGLDGSERFLRNMGCQQALGRRQKYGWTAFCHSGGPIGQAACGRCLRVTNSGTGAQQIVRIVDQCANGGLDLDEGVFKKLDTNGIGYQQGFLTVSYEFVNCND 316
            G  L+ +  +       +    R KYGWTAFC   G  GQ++CG+CL VTN+GTGA+  VRIVDQC+NGGLDLD  VF++LDT+G GY++G +TV+Y+FV+C D
Sbjct:   86 GWDLNAASAYCSTWDANKPYSWRSKYGWTAFCGPVGAHGQSSCGKCLSVTNTGTGAKTTVRIVDQCSNGGLDLDVNVFRQLDTDGKGYERGHITVNYQFVDCGD 189          
The following BLAST results are available for this feature:
BLAST of CX305778 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
PRP2_SOLLC1.062e-3673.75Pathogenesis-related protein P2 OS=Solanum lycoper... [more]
PR4A_TOBAC9.793e-3566.34Pathogenesis-related protein PR-4A OS=Nicotiana ta... [more]
PR4B_TOBAC6.347e-3465.35Pathogenesis-related protein PR-4B OS=Nicotiana ta... [more]
HEVL_ARATH1.179e-3163.41Hevein-like protein OS=Arabidopsis thaliana GN=HEL... [more]
BARW_HORVU1.120e-3060.58Barwin OS=Hordeum vulgare PE=1 SV=1[more]
WHW2_WHEAT9.485e-3059.62Wheatwin-2 OS=Triticum aestivum GN=PR4B PE=1 SV=1[more]
WIN_SOYBN2.760e-2968.29Wound-induced protein (Fragment) OS=Glycine max GN... [more]
WHW1_WHEAT6.148e-2957.69Wheatwin-1 OS=Triticum aestivum GN=PR4A PE=1 SV=1[more]
WIN2_SOLTU1.789e-2854.81Wound-induced protein WIN2 OS=Solanum tuberosum GN... [more]
HEVE_HEVBR2.336e-2852.88Pro-hevein OS=Hevea brasiliensis GN=HEV1 PE=1 SV=2[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC18010B07Rv Drought1 Citrus clementina cDNA clone C18010B07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX305778 ID=CX305778; Name=CX305778; organism=Citrus clementina; type=EST; length=355bp
GCGGGGGATGGGACTTGACGGCAGCGAGCGCTTTCTGCGCAACATGGGAT
GCCAACAAGCCCTTGGCCGGCGCCAGAAATATGGCTGGACTGCTTTCTGT
CATTCGGGCGGACCCATTGGACAAGCTGCTTGTGGCAGGTGCTTAAGGGT
CACAAACAGTGGTACAGGAGCCCAACAAATTGTGAGAATTGTTGATCAGT
GTGCCAATGGAGGCTTAGATTTGGACGAAGGAGTGTTCAAGAAATTGGAC
ACCAATGGAATAGGCTATCAACAAGGCTTCCTTACTGTCAGCTACGAGTT
TGTGAACTGCAATGATTAAAGCACCATCTATAATTCCATGATCGATCGAA
GCTTA
back to top