CX306078

Overview
NameCX306078
Unique NameCX306078
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length388
Libraries
Library NameType
Drought1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX306078 vs. ExPASy Swiss-Prot
Match: RSBQ_BACSU (Sigma factor sigB regulation protein rsbQ OS=Bacillus subtilis GN=rsbQ PE=1 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 2.949e-15
Identity = 45/125 (36.00%), Postives = 65/125 (52.00%), Query Frame = 3
Query:   12 DYYGGFEQEELDQLFEAMRSNYKAWCSGFAPLAVGGDMDSVAVQEFSRTLFNMRPDIALSVAQTIFQSDMRQILSLVSVPCHIIQSMKDLAVPVVISEYLHQNLLADSVVEVMSSDGHLPQLSSP 386
            +YYGGFE+E+L  L E M  NY  W + FA   +         +E      +  P IA   A+  F SD R+ LS V+VP  I+Q   D+  P  + +Y+HQ+L   S+ + M + GH P +S P
Sbjct:  131 EYYGGFEEEQLLGLLEMMEKNYIGWATVFAATVLNQPDRPEIKEELESRFCSTDPVIARQFAKAAFFSDHREDLSKVTVPSLILQCADDIIAPATVGKYMHQHLPYSSLKQ-MEARGHCPHMSHP 254          
The following BLAST results are available for this feature:
BLAST of CX306078 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
RSBQ_BACSU2.949e-1536.00Sigma factor sigB regulation protein rsbQ OS=Bacil... [more]
back to top
Properties
Property NameValue
Genbank descriptionC18013F12Rv Drought1 Citrus clementina cDNA clone C18013F12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX306078 ID=CX306078; Name=CX306078; organism=Citrus clementina; type=EST; length=388bp
GCGGGGATGTGGATTACTACGGAGGATTTGAGCAAGAGGAGCTGGATCAG
CTTTTTGAAGCAATGAGGTCAAATTACAAGGCATGGTGCTCTGGATTCGC
CCCGCTAGCTGTCGGCGGGGACATGGACTCGGTGGCTGTTCAAGAATTTA
GCCGAACCTTATTCAACATGAGACCAGACATAGCCTTGAGTGTGGCACAA
ACCATTTTCCAAAGTGACATGAGGCAAATTCTCAGCCTTGTCAGTGTCCC
ATGCCACATAATACAAAGCATGAAGGATTTGGCCGTGCCTGTAGTGATCT
CCGAATATCTTCATCAGAATCTCCTCGCCGATTCCGTTGTTGAAGTCATG
TCATCTGACGGTCATTTGCCGCAGCTGAGCTCCCCGGA
back to top