CX306082

Overview
NameCX306082
Unique NameCX306082
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length355
Libraries
Library NameType
Drought1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX306082 vs. ExPASy Swiss-Prot
Match: ASP_THECC (21 kDa seed protein OS=Theobroma cacao GN=ASP PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 2.599e-19
Identity = 42/84 (50.00%), Postives = 58/84 (69.05%), Query Frame = -3
Query:   75 CNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGR-SFEDGVRRLVL 323
            C+   +W++DNYD ++GKW++TT G+ G PG  TL +WFK+EK G     YK   CPSVC+SC  LC+++GR S +DG  RL L
Sbjct:  116 CSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAGVL--GYKFRFCPSVCDSCTTLCSDIGRHSDDDGQIRLAL 197          
BLAST of CX306082 vs. ExPASy Swiss-Prot
Match: MIRA_RICDU (Miraculin OS=Richadella dulcifica PE=1 SV=3)

HSP 1 Score: 81.2629 bits (199), Expect = 1.743e-15
Identity = 36/86 (41.86%), Postives = 56/86 (65.12%), Query Frame = -3
Query:   51 LWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYKIVHCPSVCESCVKLCNNVGRSFEDGVRRLVLVRDDEPAF 308
            +W++D YD ++G++F+T GG+ G+PG ET+ +WFK+E+     G YK+V CP+VC SC   C +VG   +   RR + + D   AF
Sbjct:  128 VWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCG-SGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAF 212          
The following BLAST results are available for this feature:
BLAST of CX306082 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
ASP_THECC2.599e-1950.0021 kDa seed protein OS=Theobroma cacao GN=ASP PE=2... [more]
MIRA_RICDU1.743e-1541.86Miraculin OS=Richadella dulcifica PE=1 SV=3[more]
back to top
Properties
Property NameValue
Genbank descriptionC18013G04Rv Drought1 Citrus clementina cDNA clone C18013G04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX306082 ID=CX306082; Name=CX306082; organism=Citrus clementina; type=EST; length=355bp
ATTGATTACACAGACGTTGATCTTTCTGTAGCGGGAATTAACACAACAGG
AAATGCCGGCTCATCATCACGAACCAGAACCAGACGTCGAACGCCATCCT
CAAACGAACGGCCAACGTTGTTGCAGAGTTTGACACAAGACTCGCAAACG
GATGGACAATGAACGATTTTGTATGTACCTGGAAAATTTCCAATTTTCTC
AAGCTTAAACCAATTTAGCAAAGTTTCAGCTCCAGGGTGACCATCAAGTC
CCCCGGTTGTTATAAACCATTTGCCTGATGCCGCGTCATAATTATCAACT
TTCCACAACGGTTGTTCGTTACAATAGTCACGTCCAGATAGCAACACTGA
GAATC
back to top