CX306089

Overview
NameCX306089
Unique NameCX306089
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length371
Libraries
Library NameType
Drought1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX306089 vs. ExPASy Swiss-Prot
Match: ASP_THECC (21 kDa seed protein OS=Theobroma cacao GN=ASP PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 5.857e-16
Identity = 41/95 (43.16%), Postives = 60/95 (63.16%), Query Frame = 1
Query:   70 CPLDVIQLPSDTQNGIKLTLSPYNNST-IVRESTDLNLRFSVLLSGRD-YCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIG 348
            CP  V+Q  SD  NG  +  S  ++   +VR STD+N+ F  +   RD  C+   +W++DNYD ++GKW++TT G+ G PG  TL +WFK+EK G
Sbjct:   69 CPEIVVQRRSDLDNGTPVIFSNADSKDDVVRVSTDVNIEFVPI---RDRLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAG 160          
BLAST of CX306089 vs. ExPASy Swiss-Prot
Match: MIRA_RICDU (Miraculin OS=Richadella dulcifica PE=1 SV=3)

HSP 1 Score: 74.3294 bits (181), Expect = 2.083e-13
Identity = 35/92 (38.04%), Postives = 55/92 (59.78%), Query Frame = 1
Query:   70 CPLDVIQLPSDTQNGIKLTLSPYN-NSTIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEK 342
            CP  V+Q   +  +   L   P N    +VR STDLN+ FS  +  R       +W++D YD ++G++F+T GG+ G+PG ET+ +WFK+E+
Sbjct:   76 CPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCR--WTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEE 165          
BLAST of CX306089 vs. ExPASy Swiss-Prot
Match: LSPI_CARPA (Latex serine proteinase inhibitor OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.143e-11
Identity = 46/126 (36.51%), Postives = 64/126 (50.79%), Query Frame = 1
Query:    1 YIVSAIWXXXXXXXXXXXXXXXY-CPLDVIQLPSDTQNGIKLTLSPYNN--STIVRESTDLNLRFSVLLSGRDYCNEQPLWKVDNYDAASGKWFITTGGLDGHPGAETLLNWFKLEKIGNFPGTYK 369
            ++VSAIW                 CPL V+Q P D  NG  +  S   N    IV ES DLN++F++ ++    CNE   WKVD +    G W +T GG  G+ G E+  + FK++K G  P +YK
Sbjct:   21 FVVSAIWGAGGGGLTVYGPGNKKKCPLSVVQDPFD--NGEPIIFSAIKNVKDNIVFESVDLNVKFNITIN----CNETTAWKVDRFPGVIG-WTVTLGGEKGYHGFESTHSMFKIKKAG-LPFSYK 138          
The following BLAST results are available for this feature:
BLAST of CX306089 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
ASP_THECC5.857e-1643.1621 kDa seed protein OS=Theobroma cacao GN=ASP PE=2... [more]
MIRA_RICDU2.083e-1338.04Miraculin OS=Richadella dulcifica PE=1 SV=3[more]
LSPI_CARPA1.143e-1136.51Latex serine proteinase inhibitor OS=Carica papaya... [more]
back to top
Properties
Property NameValue
Genbank descriptionC18013G11Rv Drought1 Citrus clementina cDNA clone C18013G11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX306089 ID=CX306089; Name=CX306089; organism=Citrus clementina; type=EST; length=371bp
TACATAGTCTCAGCCATCTGGGGAGCTGGCGGTGGTGGAGTTAGCCTACA
CGGTGGCAGAAACGGATATTGTCCGCTGGACGTTATCCAATTACCTTCTG
ATACGCAAAATGGAATCAAATTAACACTGTCACCGTATAACAATTCTACA
ATTGTCCGAGAATCCACTGATCTCAACTTGAGATTCTCAGTGTTGCTATC
TGGACGTGACTATTGTAACGAACAACCGTTGTGGAAAGTTGATAATTATG
ACGCGGCATCAGGCAAATGGTTTATAACAACCGGGGGACTTGATGGTCAC
CCTGGAGCTGAAACTTTGCTAAATTGGTTTAAGCTTGAGAAAATTGGAAA
TTTTCCAGGTACATACAAAAT
back to top