CX306094

Overview
NameCX306094
Unique NameCX306094
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length319
Libraries
Library NameType
Drought1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX306094 vs. ExPASy Swiss-Prot
Match: S6PD_MALDO (NADP-dependent D-sorbitol-6-phosphate dehydrogenase OS=Malus domestica GN=S6PDH PE=2 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 8.933e-33
Identity = 58/83 (69.88%), Postives = 78/83 (93.98%), Query Frame = 2
Query:   71 ITLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEAFSTGLVKREDLFITTKLWNSDHGHV 319
            +TL++G++MP+IGLG+WR+++  ++++I+NAIKIGYRH DCAA Y++EA+VGEALAEAF TGLVKRE+LFITTK+WNSDHGHV
Sbjct:    4 VTLSSGYEMPVIGLGLWRLEKDELKEVILNAIKIGYRHFDCAAHYKSEADVGEALAEAFKTGLVKREELFITTKIWNSDHGHV 86          
BLAST of CX306094 vs. ExPASy Swiss-Prot
Match: XYL1_PICGU (NADPH-dependent D-xylose reductase OS=Pichia guilliermondii GN=XYL1 PE=1 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 6.006e-21
Identity = 44/82 (53.66%), Postives = 59/82 (71.95%), Query Frame = 2
Query:   65 MAITLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEAFSTGLVKREDLFITTKLWNSDH 310
            M+ITLN+G++MP +G G W++D++   D I NAIK+GYR  D A DY NE EVGE +  A   GLV R++LF+ +KLWNS H
Sbjct:    1 MSITLNSGYEMPSVGFGCWKVDKATCADTIYNAIKVGYRLFDGAEDYGNEKEVGEGINRALDEGLVARDELFVVSKLWNSFH 82          
BLAST of CX306094 vs. ExPASy Swiss-Prot
Match: GRE3_YEAST (NADPH-dependent aldose reductase GRE3 OS=Saccharomyces cerevisiae GN=GRE3 PE=1 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.747e-20
Identity = 43/80 (53.75%), Postives = 58/80 (72.50%), Query Frame = 2
Query:   71 ITLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEAFSTGLVKREDLFITTKLWNSDH 310
            +TLNNG KMP++GLG W++D+    + I  AIK+GYR  D A DY NE EVGE + +A S GLV R+D+F+ +KLWN+ H
Sbjct:    5 VTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRKAISEGLVSRKDIFVVSKLWNNFH 84          
BLAST of CX306094 vs. ExPASy Swiss-Prot
Match: XYL2_CANTR (NADPH-dependent D-xylose reductase II,III OS=Candida tropicalis GN=xyrB PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 2.981e-20
Identity = 45/83 (54.22%), Postives = 57/83 (68.67%), Query Frame = 2
Query:   62 IMAITLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEAFSTGLVKREDLFITTKLWNSDH 310
            I  I LN+G++MP++G G W+++     D I NAIK GYR  D A DY NE EVGE +  A   GLVKRE+LFIT+KLWN+ H
Sbjct:    7 IPTIKLNSGYEMPLVGFGCWKVNNETAADQIYNAIKTGYRLFDGAEDYGNEKEVGEGINRAIKEGLVKREELFITSKLWNNFH 89          
BLAST of CX306094 vs. ExPASy Swiss-Prot
Match: XYL1_PACTA (NAD(P)H-dependent D-xylose reductase OS=Pachysolen tannophilus GN=XYL1 PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 2.981e-20
Identity = 46/79 (58.23%), Postives = 57/79 (72.15%), Query Frame = 2
Query:   74 TLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEAFSTGLVKREDLFITTKLWNSDH 310
            TLNNG K+P IG+G W+++  N  D++  AIK GYR  DCA DY NE EVGE +  A   GLVKR+DLFIT+KLWN+ H
Sbjct:    7 TLNNGRKIPAIGMGCWKLE--NAADMVYAAIKEGYRLFDCACDYGNEKEVGEGINRAIKDGLVKRKDLFITSKLWNNFH 83          
BLAST of CX306094 vs. ExPASy Swiss-Prot
Match: XYL1_KLULA (NAD(P)H-dependent D-xylose reductase OS=Kluyveromyces lactis GN=XYL1 PE=3 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 3.893e-20
Identity = 46/80 (57.50%), Postives = 54/80 (67.50%), Query Frame = 2
Query:   71 ITLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEAFSTGLVKREDLFITTKLWNSDH 310
            +TLNNG KMP++GLG W+M      D I  AIKIGYR  D A DY NE EVG+ +  A   GLVKREDL + +KLWNS H
Sbjct:    8 VTLNNGEKMPLVGLGCWKMPNDVCADQIYEAIKIGYRLFDGAQDYANEKEVGQGVNRAIKEGLVKREDLVVVSKLWNSFH 87          
BLAST of CX306094 vs. ExPASy Swiss-Prot
Match: XYL1_CANTR (NAD(P)H-dependent D-xylose reductase I,II OS=Candida tropicalis GN=xyrA PE=3 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 3.893e-20
Identity = 45/83 (54.22%), Postives = 57/83 (68.67%), Query Frame = 2
Query:   62 IMAITLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEAFSTGLVKREDLFITTKLWNSDH 310
            I  I LN+G++MP++G G W++  +   D I NAIK GYR  D A DY NE EVGE +  A   GLVKRE+LFIT+KLWN+ H
Sbjct:    7 IPTIKLNSGYEMPLVGFGCWKVTNATAADQIYNAIKTGYRLFDGAEDYGNEKEVGEGINRAIKEGLVKREELFITSKLWNNFH 89          
BLAST of CX306094 vs. ExPASy Swiss-Prot
Match: XYL1_CANSH (NAD(P)H-dependent D-xylose reductase OS=Candida shehatae GN=XYL1 PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 6.640e-20
Identity = 44/83 (53.01%), Postives = 56/83 (67.47%), Query Frame = 2
Query:   62 IMAITLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEAFSTGLVKREDLFITTKLWNSDH 310
            I A  LNNG +MP IG G W++D+S   D + NAIK GYR  D A DY NE EVGE +  A   G+V RE++F+T+KLWN+ H
Sbjct:    6 IPAFKLNNGLEMPSIGFGCWKLDKSTAADQVYNAIKAGYRLFDGAEDYGNEQEVGEGVKRAIDEGIVTREEIFLTSKLWNNYH 88          
BLAST of CX306094 vs. ExPASy Swiss-Prot
Match: AK1A1_BOVIN (Alcohol dehydrogenase [NADP+] OS=Bos taurus GN=AKR1A1 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 8.672e-20
Identity = 45/81 (55.56%), Postives = 57/81 (70.37%), Query Frame = 2
Query:   71 ITLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEAFSTG-LVKREDLFITTKLWNSDH 310
            I L+ G KMP+IGLG W+ D   ++  I  A+ +GYRHIDCAA Y NE E+GEAL E    G LV RE+LF+T+KLWN+ H
Sbjct:    6 ILLHTGQKMPLIGLGTWKSDPGQVKAAIKYALSVGYRHIDCAAIYGNETEIGEALKENVGPGKLVPREELFVTSKLWNTKH 86          
BLAST of CX306094 vs. ExPASy Swiss-Prot
Match: AK1A1_CHICK (Alcohol dehydrogenase [NADP+] OS=Gallus gallus GN=AKR1A1 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 1.479e-19
Identity = 39/81 (48.15%), Postives = 58/81 (71.60%), Query Frame = 2
Query:   71 ITLNNGFKMPIIGLGVWRMDESNIRDLIINAIKIGYRHIDCAADYRNEAEVGEALAEAFSTG-LVKREDLFITTKLWNSDH 310
            + L NG K+P+IGLG W+ +   +++ +  A+ +GYRH+DCAA Y NEAE+G+A  E      ++KREDLF+T+KLWN+ H
Sbjct:    8 VALYNGQKIPLIGLGTWKSEPGQVKEAVKYALSVGYRHVDCAAAYSNEAEIGDAFQECVGPNKVIKREDLFVTSKLWNTKH 88          
The following BLAST results are available for this feature:
BLAST of CX306094 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 94
Match NameE-valueIdentityDescription
S6PD_MALDO8.933e-3369.88NADP-dependent D-sorbitol-6-phosphate dehydrogenas... [more]
XYL1_PICGU6.006e-2153.66NADPH-dependent D-xylose reductase OS=Pichia guill... [more]
GRE3_YEAST1.747e-2053.75NADPH-dependent aldose reductase GRE3 OS=Saccharom... [more]
XYL2_CANTR2.981e-2054.22NADPH-dependent D-xylose reductase II,III OS=Candi... [more]
XYL1_PACTA2.981e-2058.23NAD(P)H-dependent D-xylose reductase OS=Pachysolen... [more]
XYL1_KLULA3.893e-2057.50NAD(P)H-dependent D-xylose reductase OS=Kluyveromy... [more]
XYL1_CANTR3.893e-2054.22NAD(P)H-dependent D-xylose reductase I,II OS=Candi... [more]
XYL1_CANSH6.640e-2053.01NAD(P)H-dependent D-xylose reductase OS=Candida sh... [more]
AK1A1_BOVIN8.672e-2055.56Alcohol dehydrogenase [NADP+] OS=Bos taurus GN=AKR... [more]
AK1A1_CHICK1.479e-1948.15Alcohol dehydrogenase [NADP+] OS=Gallus gallus GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC18013H06Rv Drought1 Citrus clementina cDNA clone C18013H06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX306094 ID=CX306094; Name=CX306094; organism=Citrus clementina; type=EST; length=319bp
GCGGGGACAGCAAGTTTTCAGAGCAAAAGCAGAGAAAGGAAGGGTGAGTG
AGTAAAGAGAAATAATGGCAATAACACTCAACAATGGATTCAAGATGCCA
ATAATTGGACTGGGTGTTTGGCGCATGGATGAATCAAACATTAGAGACCT
CATCATCAATGCCATCAAGATTGGCTATCGCCATATTGACTGTGCTGCTG
ATTATAGGAATGAAGCGGAAGTTGGGGAGGCACTTGCAGAAGCATTTAGC
ACTGGGCTTGTCAAGAGGGAGGATCTTTTCATTACCACCAAGCTTTGGAA
TTCAGATCATGGACATGTT
back to top