CX306356
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX306356 vs. ExPASy Swiss-Prot
Match: PROF1_RICCO (Profilin-1 OS=Ricinus communis GN=PRO1 PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 9.085e-12 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = -2 Query: 415 ALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 510 ALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL Sbjct: 100 ALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 131
BLAST of CX306356 vs. ExPASy Swiss-Prot
Match: PROF_CUCME (Profilin OS=Cucumis melo PE=1 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.186e-11 Identity = 31/32 (96.88%), Postives = 32/32 (100.00%), Query Frame = -2 Query: 415 ALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 510 AL+IGIYDEPMTPGQCNMIVERLGDYLIDQGL Sbjct: 100 ALVIGIYDEPMTPGQCNMIVERLGDYLIDQGL 131
BLAST of CX306356 vs. ExPASy Swiss-Prot
Match: PROF2_SOYBN (Profilin-2 OS=Glycine max GN=PRO2 PE=1 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.186e-11 Identity = 31/32 (96.88%), Postives = 32/32 (100.00%), Query Frame = -2 Query: 418 AALIIGIYDEPMTPGQCNMIVERLGDYLIDQG 513 AALIIGIYDEPMTPGQCNM+VERLGDYLIDQG Sbjct: 99 AALIIGIYDEPMTPGQCNMVVERLGDYLIDQG 130
BLAST of CX306356 vs. ExPASy Swiss-Prot
Match: PROF_LITCN (Profilin OS=Litchi chinensis PE=1 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 1.550e-11 Identity = 30/32 (93.75%), Postives = 32/32 (100.00%), Query Frame = -2 Query: 415 ALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 510 ALIIGIYDEPMTPGQCNM+VERLGDYL+DQGL Sbjct: 100 ALIIGIYDEPMTPGQCNMVVERLGDYLVDQGL 131
BLAST of CX306356 vs. ExPASy Swiss-Prot
Match: PROF2_HEVBR (Profilin-2 OS=Hevea brasiliensis GN=PRO2 PE=1 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 2.643e-11 Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = -2 Query: 418 ALIIGIYDEPMTPGQCNMIVERLGDYLIDQG 510 ALIIGIYDEPMTPGQCNMIVERLGDYLIDQG Sbjct: 100 ALIIGIYDEPMTPGQCNMIVERLGDYLIDQG 130
BLAST of CX306356 vs. ExPASy Swiss-Prot
Match: PROF6_HEVBR (Profilin-6 OS=Hevea brasiliensis PE=1 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 3.452e-11 Identity = 30/32 (93.75%), Postives = 32/32 (100.00%), Query Frame = -2 Query: 415 ALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 510 ALIIGIYDEP+TPGQCNMIVERLGDYL+DQGL Sbjct: 100 ALIIGIYDEPLTPGQCNMIVERLGDYLLDQGL 131
BLAST of CX306356 vs. ExPASy Swiss-Prot
Match: PROF1_PHAVU (Profilin-1 OS=Phaseolus vulgaris PE=1 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 3.452e-11 Identity = 30/32 (93.75%), Postives = 32/32 (100.00%), Query Frame = -2 Query: 415 ALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 510 AL+IGIYDEPMTPGQCNMIVERLGDYLI+QGL Sbjct: 100 ALVIGIYDEPMTPGQCNMIVERLGDYLIEQGL 131
BLAST of CX306356 vs. ExPASy Swiss-Prot
Match: PROF_PRUPE (Profilin OS=Prunus persica PE=1 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 5.888e-11 Identity = 29/32 (90.62%), Postives = 32/32 (100.00%), Query Frame = -2 Query: 415 ALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 510 AL+IGIYDEPMTPGQCNMIVERLGDYL++QGL Sbjct: 100 ALLIGIYDEPMTPGQCNMIVERLGDYLVEQGL 131
BLAST of CX306356 vs. ExPASy Swiss-Prot
Match: PROF_PRUDU (Profilin OS=Prunus dulcis PE=1 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 5.888e-11 Identity = 30/32 (93.75%), Postives = 32/32 (100.00%), Query Frame = -2 Query: 415 ALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 510 ALIIGIYDEP+TPGQCNMIVERLGDYLI+QGL Sbjct: 100 ALIIGIYDEPLTPGQCNMIVERLGDYLIEQGL 131
BLAST of CX306356 vs. ExPASy Swiss-Prot
Match: PROF_PRUAV (Profilin OS=Prunus avium PE=1 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 5.888e-11 Identity = 30/32 (93.75%), Postives = 32/32 (100.00%), Query Frame = -2 Query: 415 ALIIGIYDEPMTPGQCNMIVERLGDYLIDQGL 510 ALIIGIYDEP+TPGQCNMIVERLGDYLI+QGL Sbjct: 100 ALIIGIYDEPLTPGQCNMIVERLGDYLIEQGL 131 The following BLAST results are available for this feature:
BLAST of CX306356 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 18
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX306356 ID=CX306356; Name=CX306356; organism=Citrus clementina; type=EST; length=517bpback to top |