CX308549

Overview
NameCX308549
Unique NameCX308549
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length243
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15280 contig Ccv1_Contig15280:247..489. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308549 vs. ExPASy Swiss-Prot
Match: RL72_ARATH (60S ribosomal protein L7-2 OS=Arabidopsis thaliana GN=RPL7B PE=1 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 1.955e-35
Identity = 73/80 (91.25%), Postives = 78/80 (97.50%), Query Frame = -3
Query:    2 EEQKELIRLKREAKLKGGFYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTY 241
            E++KELI LKREAKLKGGFYV+PEAKLLFIIRIRGINA+DPKTKKILQLLRLRQIFNGVFLKVNKAT+NML RVEPYVTY
Sbjct:   57 EKEKELISLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATMNMLRRVEPYVTY 136          
BLAST of CX308549 vs. ExPASy Swiss-Prot
Match: RL74_ARATH (60S ribosomal protein L7-4 OS=Arabidopsis thaliana GN=RPL7D PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 2.553e-35
Identity = 72/80 (90.00%), Postives = 79/80 (98.75%), Query Frame = -3
Query:    2 EEQKELIRLKREAKLKGGFYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTY 241
            E+++ELI+LKREAKLKGGFYV+PEAKLLFIIRIRGINA+DPKTKKILQLLRLRQIFNGVFLKVNKAT+NML RVEPYVTY
Sbjct:   59 EKERELIQLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATINMLRRVEPYVTY 138          
BLAST of CX308549 vs. ExPASy Swiss-Prot
Match: RL73_ARATH (60S ribosomal protein L7-3 OS=Arabidopsis thaliana GN=RPL7C PE=2 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 3.334e-35
Identity = 73/80 (91.25%), Postives = 77/80 (96.25%), Query Frame = -3
Query:    2 EEQKELIRLKREAKLKGGFYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTY 241
            E+  ELIRLKREAKLKGGFYV+PEAKLLFIIRIRGINA+DPKTKKILQLLRLRQIFNGVFLKVNKAT+NML RVEPYVTY
Sbjct:   57 EKDNELIRLKREAKLKGGFYVDPEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATVNMLRRVEPYVTY 136          
BLAST of CX308549 vs. ExPASy Swiss-Prot
Match: RL7_DROME (60S ribosomal protein L7 OS=Drosophila melanogaster GN=RpL7 PE=2 SV=2)

HSP 1 Score: 100.138 bits (248), Expect = 3.579e-21
Identity = 50/79 (63.29%), Postives = 63/79 (79.75%), Query Frame = -3
Query:    2 EQKELIRLKREAKLKGGFYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTY 238
            EQ+E I+L+R AK +  FYV  EAKL F++RIRGIN V PK +K+LQL RLRQI NGVF+K+NKAT+NML   EPY+T+
Sbjct:   68 EQRE-IKLRRLAKKRNQFYVPAEAKLAFVVRIRGINKVAPKVRKVLQLFRLRQINNGVFIKLNKATINMLRIAEPYITW 145          
BLAST of CX308549 vs. ExPASy Swiss-Prot
Match: RL7_DICDI (60S ribosomal protein L7 OS=Dictyostelium discoideum GN=rpl7 PE=1 SV=3)

HSP 1 Score: 100.138 bits (248), Expect = 3.579e-21
Identity = 49/78 (62.82%), Postives = 61/78 (78.21%), Query Frame = -3
Query:    2 QKELIRLKREAKLKGGFYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTY 235
            ++E IRL R AK  G FYV P AK+ F+IRIRGIN V PK +K+L+LLRL Q+ NGVF+K+NKA++NML  VEPYV Y
Sbjct:   63 EREAIRLNRIAKNSGTFYVPPAAKVAFVIRIRGINGVSPKPRKVLKLLRLLQLNNGVFVKLNKASINMLKLVEPYVAY 140          
BLAST of CX308549 vs. ExPASy Swiss-Prot
Match: RL7_CAEEL (60S ribosomal protein L7 OS=Caenorhabditis elegans GN=rpl-7 PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 3.579e-21
Identity = 49/78 (62.82%), Postives = 62/78 (79.49%), Query Frame = -3
Query:    2 QKELIRLKREAKLKGGFYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTY 235
            QKE +RLKREA+ KG FYV  E K+ F++RIRGIN + PK +K LQ+LRLRQI NGVF+K+NKATL +L  +EPYV +
Sbjct:   61 QKEGLRLKREAEAKGDFYVPAEHKVAFVVRIRGINQLHPKPRKALQILRLRQINNGVFVKLNKATLPLLRIIEPYVAW 138          
BLAST of CX308549 vs. ExPASy Swiss-Prot
Match: RL7_PONAB (60S ribosomal protein L7 OS=Pongo abelii GN=RPL7 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 6.105e-21
Identity = 47/74 (63.51%), Postives = 58/74 (78.38%), Query Frame = -3
Query:    2 IRLKREAKLKGGFYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTY 223
            IR+ R A+  G FYV  E KL F+IRIRGIN V PK +K+LQLLRLRQIFNG F+K+NKA++NML  VEPY+ +
Sbjct:   68 IRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAW 141          
BLAST of CX308549 vs. ExPASy Swiss-Prot
Match: RL7_MOUSE (60S ribosomal protein L7 OS=Mus musculus GN=Rpl7 PE=2 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 6.105e-21
Identity = 47/74 (63.51%), Postives = 58/74 (78.38%), Query Frame = -3
Query:    2 IRLKREAKLKGGFYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTY 223
            IR+ R A+  G FYV  E KL F+IRIRGIN V PK +K+LQLLRLRQIFNG F+K+NKA++NML  VEPY+ +
Sbjct:   91 IRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAW 164          
BLAST of CX308549 vs. ExPASy Swiss-Prot
Match: RL7_MACFA (60S ribosomal protein L7 OS=Macaca fascicularis GN=RPL7 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 6.105e-21
Identity = 47/74 (63.51%), Postives = 58/74 (78.38%), Query Frame = -3
Query:    2 IRLKREAKLKGGFYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTY 223
            IR+ R A+  G FYV  E KL F+IRIRGIN V PK +K+LQLLRLRQIFNG F+K+NKA++NML  VEPY+ +
Sbjct:   68 IRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAW 141          
BLAST of CX308549 vs. ExPASy Swiss-Prot
Match: RL7_HUMAN (60S ribosomal protein L7 OS=Homo sapiens GN=RPL7 PE=1 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 6.105e-21
Identity = 47/74 (63.51%), Postives = 58/74 (78.38%), Query Frame = -3
Query:    2 IRLKREAKLKGGFYVNPEAKLLFIIRIRGINAVDPKTKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTY 223
            IR+ R A+  G FYV  E KL F+IRIRGIN V PK +K+LQLLRLRQIFNG F+K+NKA++NML  VEPY+ +
Sbjct:   69 IRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAW 142          
The following BLAST results are available for this feature:
BLAST of CX308549 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
RL72_ARATH1.955e-3591.2560S ribosomal protein L7-2 OS=Arabidopsis thaliana... [more]
RL74_ARATH2.553e-3590.0060S ribosomal protein L7-4 OS=Arabidopsis thaliana... [more]
RL73_ARATH3.334e-3591.2560S ribosomal protein L7-3 OS=Arabidopsis thaliana... [more]
RL7_DROME3.579e-2163.2960S ribosomal protein L7 OS=Drosophila melanogaste... [more]
RL7_DICDI3.579e-2162.8260S ribosomal protein L7 OS=Dictyostelium discoide... [more]
RL7_CAEEL3.579e-2162.8260S ribosomal protein L7 OS=Caenorhabditis elegans... [more]
RL7_PONAB6.105e-2163.5160S ribosomal protein L7 OS=Pongo abelii GN=RPL7 P... [more]
RL7_MOUSE6.105e-2163.5160S ribosomal protein L7 OS=Mus musculus GN=Rpl7 P... [more]
RL7_MACFA6.105e-2163.5160S ribosomal protein L7 OS=Macaca fascicularis GN... [more]
RL7_HUMAN6.105e-2163.5160S ribosomal protein L7 OS=Homo sapiens GN=RPL7 P... [more]

Pages

back to top
Libraries
Library NameType
AbsLeaSub1cdna_library
Properties
Property NameValue
Genbank descriptionC21001B12Rv AbsLeaSub1 Citrus clementina cDNA clone C21001B12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308549 ID=CX308549|Name=CX308549|organism=Citrus clementina|type=EST|length=243bp
CATATGTTACATAGGGCTCAACTCTGTGCAGCATATTGAGTGTGGCTTTG
TTCACTTTCAAAAAGACACCATTAAAAATCTGTCTCAAACGGAGAAGCTG
CAAAATTTTCTTGGTCTTTGGATCAACAGCATTGATACCGCGAATCCTGA
TAATGAACAAAAGCTTAGCTTCTGGGTTGACATAAAATCCACCCTTAAGC
TTGGCCTCACGCTTCAAACGAATGAGTTCTTTTTGCTCTTCAT
back to top