CX308550

Overview
NameCX308550
Unique NameCX308550
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length460
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX308550 vs. ExPASy Swiss-Prot
Match: GUN2_PERAE (Endoglucanase 2 (Fragment) OS=Persea americana GN=CEL2 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 6.049e-13
Identity = 35/58 (60.34%), Postives = 39/58 (67.24%), Query Frame = 1
Query:    1 YSRSPNPNVLSGAILGGPXXXXXXXXXXXXYQQSEPATYINAPFVGAVAFFSSKTTTN 174
            YS SPNPN+L GAILGGP            YQQSEPATYINAP VGA+AFF++    N
Sbjct:   73 YSSSPNPNILVGAILGGPDSRDSFSDDRNNYQQSEPATYINAPLVGALAFFAANPVAN 130          
BLAST of CX308550 vs. ExPASy Swiss-Prot
Match: GUN1_PERAE (Endoglucanase 1 OS=Persea americana GN=CEL1 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 3.002e-12
Identity = 34/57 (59.65%), Postives = 38/57 (66.67%), Query Frame = 1
Query:    1 YSRSPNPNVLSGAILGGPXXXXXXXXXXXXYQQSEPATYINAPFVGAVAFFSSKTTT 171
            YS  PNPN+L GAILGGP            YQQSEPATYINAP VGA+AFF++   T
Sbjct:  437 YSSPPNPNILVGAILGGPDNRDSFSDDRNNYQQSEPATYINAPLVGALAFFAANPVT 493          
The following BLAST results are available for this feature:
BLAST of CX308550 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
GUN2_PERAE6.049e-1360.34Endoglucanase 2 (Fragment) OS=Persea americana GN=... [more]
GUN1_PERAE3.002e-1259.65Endoglucanase 1 OS=Persea americana GN=CEL1 PE=2 S... [more]
back to top
Libraries
Library NameType
AbsLeaSub1cdna_library
Properties
Property NameValue
Genbank descriptionC21001C01Rv AbsLeaSub1 Citrus clementina cDNA clone C21001C01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308550 ID=CX308550|Name=CX308550|organism=Citrus clementina|type=EST|length=460bp
TACTCTAGATCACCCAATCCAAATGTTCTCAGTGGAGCTATATTAGGTGG
GCCTGATAATAGAGACAATTTTGCCGATGATCGTAATAATTATCAGCAGT
CAGAACCAGCTACATACATCAATGCGCCGTTTGTTGGTGCTGTTGCTTTC
TTCTCATCCAAAACCACCACAAATTAACTAAAATGTTCTTTGTTTCTTTC
TTGAGGATTGGCGTGAATCTGTCTTATCCTGTGTGATGTGAGAATTTGAG
AAGTTTGGTTTACAATGCTTCCAATTCCACGTCAGAACTGTAACCTCTAA
TAATTCTTCTCTTGAGTTTTTGAGTAATATGGTAAGTAATATATCAATTG
TGGCAAAAGAGATATCTTTGCCAACTTTGAGTTAATGTTGACTTTCTTAC
CGTTTAATAAAATGAATCAATTTTTTAAAAAACANANNAAAAAAAAAAAA
AAAAAAAAAA
back to top