CX309110

Overview
NameCX309110
Unique NameCX309110
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length419
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX309110 vs. ExPASy Swiss-Prot
Match: FRAY2_DICDI (Serine/threonine-protein kinase fray2 OS=Dictyostelium discoideum GN=fray2 PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.185e-16
Identity = 41/91 (45.05%), Postives = 56/91 (61.54%), Query Frame = -2
Query:  146 LMALQNAPPGLDYERDRKFSKSFKQMIASCLVKDPSKRPSAKKLLKHSFFKQARSNEYIARTLLEGLPALGDRIKALKKKEEDMLAQKKMP 418
            L+ LQN PP L+ + + K+S SFK ++  CL KDPSKRP   KLL+H FFKQA+  +Y+ + +L  LP LG R + L +    ML     P
Sbjct:  281 LLTLQNPPPSLEGDGESKWSHSFKDLVEKCLQKDPSKRPLPSKLLEHRFFKQAKKPDYLVQHILAKLPPLGQRYQMLSEDSFAMLRNTSSP 371          
BLAST of CX309110 vs. ExPASy Swiss-Prot
Match: OXSR1_PIG (Serine/threonine-protein kinase OSR1 OS=Sus scrofa GN=OXSR1 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.448e-14
Identity = 38/98 (38.78%), Postives = 60/98 (61.22%), Query Frame = -2
Query:  140 LMALQNAPPGL-----DYERDRKFSKSFKQMIASCLVKDPSKRPSAKKLLKHSFFKQARSNEYIARTLLEGLPALGDRIKALKKKEEDMLAQKKMPDG 418
            ++ LQN PP L     D E  +K+ KSF++MI+ CL KDP KRP+A +LL+H FF++A++ EY+   +L+  P + +R K +++         K  DG
Sbjct:  237 MLTLQNDPPSLETGVQDKEMLKKYGKSFRKMISLCLQKDPEKRPTAAELLRHKFFQKAKNKEYLQEKILQRAPTISERAKKVRRVPGSSGRLHKTEDG 334          
BLAST of CX309110 vs. ExPASy Swiss-Prot
Match: OXSR1_PONAB (Serine/threonine-protein kinase OSR1 OS=Pongo abelii GN=OXSR1 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.214e-14
Identity = 37/98 (37.76%), Postives = 60/98 (61.22%), Query Frame = -2
Query:  140 LMALQNAPPGL-----DYERDRKFSKSFKQMIASCLVKDPSKRPSAKKLLKHSFFKQARSNEYIARTLLEGLPALGDRIKALKKKEEDMLAQKKMPDG 418
            ++ LQN PP L     D E  +K+ KSF++MI+ CL KDP KRP+A +LL+H FF++A++ E++   +L+  P + +R K +++         K  DG
Sbjct:  237 MLTLQNDPPSLETGVQDKEMLKKYGKSFRKMISLCLQKDPEKRPTAAELLRHKFFQKAKNKEFLQEKILQRAPTISERAKKVRRVPGSSGRLHKTEDG 334          
BLAST of CX309110 vs. ExPASy Swiss-Prot
Match: OXSR1_MOUSE (Serine/threonine-protein kinase OSR1 OS=Mus musculus GN=Oxsr1 PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 5.503e-14
Identity = 37/98 (37.76%), Postives = 60/98 (61.22%), Query Frame = -2
Query:  140 LMALQNAPPGL-----DYERDRKFSKSFKQMIASCLVKDPSKRPSAKKLLKHSFFKQARSNEYIARTLLEGLPALGDRIKALKKKEEDMLAQKKMPDG 418
            ++ LQN PP L     D E  +K+ KSF++MI+ CL KDP KRP+A +LL+H FF++A++ E++   +L+  P + +R K +++         K  DG
Sbjct:  237 MLTLQNDPPSLETGVQDKEMLKKYGKSFRKMISLCLQKDPEKRPTAAELLRHKFFQKAKNKEFLQEKILQRAPTISERSKKVRRVPGSSGRLHKTEDG 334          
BLAST of CX309110 vs. ExPASy Swiss-Prot
Match: OXSR1_HUMAN (Serine/threonine-protein kinase OSR1 OS=Homo sapiens GN=OXSR1 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 9.387e-14
Identity = 37/98 (37.76%), Postives = 59/98 (60.20%), Query Frame = -2
Query:  140 LMALQNAPPGL-----DYERDRKFSKSFKQMIASCLVKDPSKRPSAKKLLKHSFFKQARSNEYIARTLLEGLPALGDRIKALKKKEEDMLAQKKMPDG 418
            ++ LQN PP L     D E  +K+ KSF++MI+ CL KDP KRP+A +LL+H FF++A++ E++    L+  P + +R K +++         K  DG
Sbjct:  237 MLTLQNDPPSLETGVQDKEMLKKYGKSFRKMISLCLQKDPEKRPTAAELLRHKFFQKAKNKEFLQEKTLQRAPTISERAKKVRRVPGSSGRLHKTEDG 334          
BLAST of CX309110 vs. ExPASy Swiss-Prot
Match: STK39_RAT (STE20/SPS1-related proline-alanine-rich protein kinase OS=Rattus norvegicus GN=Stk39 PE=2 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 6.084e-13
Identity = 39/101 (38.61%), Postives = 59/101 (58.42%), Query Frame = -2
Query:  131 LMALQNAPPGL-----DYERDRKFSKSFKQMIASCLVKDPSKRPSAKKLLKHSFFKQARSNEYIARTLLEGLPALGDRIKALKKKEEDMLAQKKMPDGQKE 418
            ++ LQN PP L     D E  +K+ KSF+++++ CL KDPSKRP+A +LLK  FF++A++ EY+   LL   P +  R K +++         K  DG  E
Sbjct:  292 MLTLQNDPPTLETGVEDKEMMKKYGKSFRKLLSLCLQKDPSKRPTAAELLKCKFFQKAKNREYLIEKLLTRTPDIAQRAKKVRRVPGSSGHLHKTEDGDWE 392          
BLAST of CX309110 vs. ExPASy Swiss-Prot
Match: STK39_MOUSE (STE20/SPS1-related proline-alanine-rich protein kinase OS=Mus musculus GN=Stk39 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 6.084e-13
Identity = 39/101 (38.61%), Postives = 59/101 (58.42%), Query Frame = -2
Query:  131 LMALQNAPPGL-----DYERDRKFSKSFKQMIASCLVKDPSKRPSAKKLLKHSFFKQARSNEYIARTLLEGLPALGDRIKALKKKEEDMLAQKKMPDGQKE 418
            ++ LQN PP L     D E  +K+ KSF+++++ CL KDPSKRP+A +LLK  FF++A++ EY+   LL   P +  R K +++         K  DG  E
Sbjct:  295 MLTLQNDPPTLETGVEDKEMMKKYGKSFRKLLSLCLQKDPSKRPTAAELLKCKFFQKAKNREYLIEKLLTRTPDIAQRAKKVRRVPGSSGHLHKTEDGDWE 395          
BLAST of CX309110 vs. ExPASy Swiss-Prot
Match: STK39_HUMAN (STE20/SPS1-related proline-alanine-rich protein kinase OS=Homo sapiens GN=STK39 PE=1 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 6.084e-13
Identity = 39/101 (38.61%), Postives = 59/101 (58.42%), Query Frame = -2
Query:  131 LMALQNAPPGL-----DYERDRKFSKSFKQMIASCLVKDPSKRPSAKKLLKHSFFKQARSNEYIARTLLEGLPALGDRIKALKKKEEDMLAQKKMPDGQKE 418
            ++ LQN PP L     D E  +K+ KSF+++++ CL KDPSKRP+A +LLK  FF++A++ EY+   LL   P +  R K +++         K  DG  E
Sbjct:  285 MLTLQNDPPTLETGVEDKEMMKKYGKSFRKLLSLCLQKDPSKRPTAAELLKCKFFQKAKNREYLIEKLLTRTPDIAQRAKKVRRVPGSSGHLHKTEDGDWE 385          
The following BLAST results are available for this feature:
BLAST of CX309110 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
FRAY2_DICDI1.185e-1645.05Serine/threonine-protein kinase fray2 OS=Dictyoste... [more]
OXSR1_PIG1.448e-1438.78Serine/threonine-protein kinase OSR1 OS=Sus scrofa... [more]
OXSR1_PONAB4.214e-1437.76Serine/threonine-protein kinase OSR1 OS=Pongo abel... [more]
OXSR1_MOUSE5.503e-1437.76Serine/threonine-protein kinase OSR1 OS=Mus muscul... [more]
OXSR1_HUMAN9.387e-1437.76Serine/threonine-protein kinase OSR1 OS=Homo sapie... [more]
STK39_RAT6.084e-1338.61STE20/SPS1-related proline-alanine-rich protein ki... [more]
STK39_MOUSE6.084e-1338.61STE20/SPS1-related proline-alanine-rich protein ki... [more]
STK39_HUMAN6.084e-1338.61STE20/SPS1-related proline-alanine-rich protein ki... [more]
back to top
Properties
Property NameValue
Genbank descriptionC21008F09Rv AbsLeaSub1 Citrus clementina cDNA clone C21008F09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX309110 ID=CX309110|Name=CX309110|organism=Citrus clementina|type=EST|length=419bp
TCGAGCTCCCTCCATGATTGCTCTCAGATATCATGTCCTCATCTTGGATC
AGGGAAGCCTGAGCCTTCACATCTTCAAGATTGAAATTCCAGCCACTAAT
CCCTCGCTTATATTCATTCTGTGATATTTCCTCTTTCTGCCCATCTGGCA
TTTTCTTCTGTGCAAGCATATCTTCTTCCTTTTTCTTCAATGCTTTAATA
CGATCACCAAGAGCAGGCAACCCCTCCAAAAGTGTCCGTGCTATATACTC
ATTTGACCTAGCTTGCTTGAAAAATGAATGTTTTAACAACTTTTTTGCTG
AAGGCCTTTTTGAAGGATCTTTCACCAAGCAACTGGCAATCATCTGCTTA
AAAGACTTAGAAAATTTCCTATCTCTTTCATAATCAAGGCCAGGGGGCGC
ATTTTGCAATGCCATAAGC
back to top