CX309114

Overview
NameCX309114
Unique NameCX309114
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length315
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9418 contig Ccv1_Contig9418:267..581. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX309114 vs. ExPASy Swiss-Prot
Match: JMT_BRARP (Jasmonate O-methyltransferase OS=Brassica rapa subsp. pekinensis GN=JMT PE=1 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.447e-22
Identity = 52/106 (49.06%), Postives = 64/106 (60.38%), Query Frame = 1
Query:    7 VNKICDKLGSQLPEFQVFLNDLPGNDFNTIFRSLASFQKILRKQ------LGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSLQWLSQVPDGLESNKGNI 306
            +  +C  L   +PE  + LNDLP NDFN IF SL  F   ++K+      LG   G+ G CF + VPGSFYGRLFPR S+H  HSS SL WLSQVP G  + K  +
Sbjct:   77 IQNLCHDLDRPVPELSLSLNDLPSNDFNYIFASLPEFYDRVKKRDNNYESLGFEHGSGGPCFVSAVPGSFYGRLFPRRSLHFVHSSSSLHWLSQVPCGEVNKKDGV 182          
BLAST of CX309114 vs. ExPASy Swiss-Prot
Match: BAMT_ANTMA (Benzoate carboxyl methyltransferase OS=Antirrhinum majus GN=BAMT PE=1 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 5.451e-22
Identity = 51/95 (53.68%), Postives = 65/95 (68.42%), Query Frame = 1
Query:   34 SQLPEFQVFLNDLPGNDFNTIFRSLASFQKILRKQLGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSLQWLSQVPDGLE-SNKGNIFMA 315
            ++LPEF+VFLNDLP NDFN +F+ L              S   G CF  G+PGSFYGRL P+ S+H  +SSYS+ WLSQVP+GLE +N+ NI+MA
Sbjct:   90 NELPEFEVFLNDLPDNDFNNLFKLL--------------SHENGNCFVYGLPGSFYGRLLPKKSLHFAYSSYSIHWLSQVPEGLEDNNRQNIYMA 170          
BLAST of CX309114 vs. ExPASy Swiss-Prot
Match: JMT_ARATH (Jasmonate O-methyltransferase OS=Arabidopsis thaliana GN=JMT PE=1 SV=2)

HSP 1 Score: 96.2857 bits (238), Expect = 5.102e-20
Identity = 48/93 (51.61%), Postives = 58/93 (62.37%), Query Frame = 1
Query:    7 VNKICDKLGSQLPEFQVFLNDLPGNDFNTIFRSLASFQKIL---RKQLGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSLQWLSQVP 276
            ++ +C  L   +PE +V LNDLP NDFN I  SL  F   +   ++ LG   G    CF + VPGSFYGRLFPR S+H  HSS SL WLSQVP
Sbjct:   77 IHNLCPDLDRPVPELRVSLNDLPSNDFNYICASLPEFYDRVNNNKEGLGFGRGGGESCFVSAVPGSFYGRLFPRRSLHFVHSSSSLHWLSQVP 169          
BLAST of CX309114 vs. ExPASy Swiss-Prot
Match: MT810_ARATH (Probable S-adenosylmethionine-dependent methyltransferase At5g38100 OS=Arabidopsis thaliana GN=At5g38100 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.301e-15
Identity = 40/84 (47.62%), Postives = 50/84 (59.52%), Query Frame = 1
Query:   46 EFQVFLNDLPGNDFNTIFRSLASFQKILRKQLGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSLQWLSQVPDGLESNK 297
            EFQVF ND P NDFNT+FR+                    + F  GVPGSFYGR+ PRNS+H+ H+SY+  WLS+VPD +   K
Sbjct:   97 EFQVFFNDQPTNDFNTLFRT-------------QPLSPEREYFSVGVPGSFYGRVLPRNSIHIGHTSYTTHWLSKVPDNVCDKK 167          
BLAST of CX309114 vs. ExPASy Swiss-Prot
Match: MT878_ARATH (Probable S-adenosylmethionine-dependent methyltransferase At5g38780 OS=Arabidopsis thaliana GN=At5g38780 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 1.101e-14
Identity = 37/78 (47.44%), Postives = 50/78 (64.10%), Query Frame = 1
Query:   46 EFQVFLNDLPGNDFNTIFRSLASFQKILRKQLGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSLQWLSQVPD 279
            EFQV+ NDLP NDFNT+FR+     K              + F  GVPGSFYGR+ PRNS+H+ ++S++  WLS+VP+
Sbjct:   99 EFQVYFNDLPNNDFNTLFRTQPPSSK-------------QEYFSVGVPGSFYGRVLPRNSIHIGNTSFTTHWLSKVPE 163          
BLAST of CX309114 vs. ExPASy Swiss-Prot
Match: MT797_ARATH (Probable S-adenosylmethionine-dependent methyltransferase At5g37970 OS=Arabidopsis thaliana GN=At5g37970 PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 3.203e-14
Identity = 37/77 (48.05%), Postives = 48/77 (62.34%), Query Frame = 1
Query:   46 EFQVFLNDLPGNDFNTIFRSLASFQKILRKQLGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSLQWLSQVP 276
            EFQV  ND P NDFNT+FR+   F +              + F  GVPGSF+GR+ P+NS+H+ H+SY+L WLS VP
Sbjct:  100 EFQVCFNDQPNNDFNTLFRTQPFFSR-------------KEYFSVGVPGSFHGRVLPKNSLHIGHTSYTLHWLSNVP 163          
BLAST of CX309114 vs. ExPASy Swiss-Prot
Match: MT799_ARATH (Probable S-adenosylmethionine-dependent methyltransferase At5g37990 OS=Arabidopsis thaliana GN=At5g37990 PE=2 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 1.030e-12
Identity = 38/77 (49.35%), Postives = 48/77 (62.34%), Query Frame = 1
Query:   46 EFQVFLNDLPGNDFNTIFRSLASFQKILRKQLGSASGAAGQCFFTGVPGSFYGRLFPRNSVHLFHSSYSLQWLSQVP 276
            EFQV  ND P NDFNT+FR+    Q I  KQ   +          GVPGSF+GR+ P+NS+H+ H +Y+L WLS VP
Sbjct:  100 EFQVCFNDQPNNDFNTLFRT----QPISSKQAYLS---------VGVPGSFHGRVLPKNSLHIGHITYALHWLSTVP 163          
The following BLAST results are available for this feature:
BLAST of CX309114 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
JMT_BRARP2.447e-2249.06Jasmonate O-methyltransferase OS=Brassica rapa sub... [more]
BAMT_ANTMA5.451e-2253.68Benzoate carboxyl methyltransferase OS=Antirrhinum... [more]
JMT_ARATH5.102e-2051.61Jasmonate O-methyltransferase OS=Arabidopsis thali... [more]
MT810_ARATH1.301e-1547.62Probable S-adenosylmethionine-dependent methyltran... [more]
MT878_ARATH1.101e-1447.44Probable S-adenosylmethionine-dependent methyltran... [more]
MT797_ARATH3.203e-1448.05Probable S-adenosylmethionine-dependent methyltran... [more]
MT799_ARATH1.030e-1249.35Probable S-adenosylmethionine-dependent methyltran... [more]
back to top
Properties
Property NameValue
Genbank descriptionC21008G01Rv AbsLeaSub1 Citrus clementina cDNA clone C21008G01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX309114 ID=CX309114|Name=CX309114|organism=Citrus clementina|type=EST|length=315bp
GCGGGAGTGAACAAGATCTGCGATAAGTTGGGCAGTCAATTACCAGAATT
TCAAGTGTTCCTGAACGATCTTCCAGGGAATGACTTTAACACCATTTTCA
GGTCTTTAGCAAGCTTCCAAAAGATACTGAGAAAGCAATTAGGGTCGGCC
TCTGGGGCAGCTGGGCAGTGCTTCTTCACTGGGGTCCCTGGTTCTTTCTA
TGGCAGGCTTTTCCCTCGCAATAGTGTGCATCTTTTCCACTCTTCTTATA
GTCTCCAATGGCTATCTCAAGTTCCAGATGGACTGGAGAGCAATAAAGGG
AACATTTTCATGGCC
back to top