CX309116

Overview
NameCX309116
Unique NameCX309116
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length445
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig735 contig Ccv1_Contig735:257..702. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX309116 vs. ExPASy Swiss-Prot
Match: HBL1_GOSHI (Non-symbiotic hemoglobin 1 OS=Gossypium hirsutum GN=HB1 PE=2 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 1.261e-57
Identity = 111/124 (89.52%), Postives = 116/124 (93.55%), Query Frame = -2
Query:    1 EGRAFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKEA 372
            EG+ FTEEQEALVVKSW VMKK   ELGLKFFL+IFEIAPSA+KLFSFLRDSNVPLEQN KLKPHAMSVFVMTCESAVQLRKAGKVTVRES LKKLGA HFKYGVV+EHFEVTKF+LLETIKEA
Sbjct:    5 EGKVFTEEQEALVVKSWTVMKKKTAELGLKFFLKIFEIAPSAKKLFSFLRDSNVPLEQNTKLKPHAMSVFVMTCESAVQLRKAGKVTVRESNLKKLGATHFKYGVVDEHFEVTKFALLETIKEA 128          
BLAST of CX309116 vs. ExPASy Swiss-Prot
Match: HBP2_CASGL (Hemoglobin-2 OS=Casuarina glauca GN=HBII PE=3 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 5.297e-56
Identity = 108/124 (87.10%), Postives = 117/124 (94.35%), Query Frame = -2
Query:    1 EGRAFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKEA 372
            EGR FTEEQEALVVKSW+ MK NAGELGLKFFL+IFEIAPSAQKLFSFL+DSNVPLE+N KLK HAMSVF+MTCESAVQLRKAGKVTVRES+LKKLGA HFK+GV +EHFEVTKF+LLETIKEA
Sbjct:    5 EGRGFTEEQEALVVKSWSAMKPNAGELGLKFFLKIFEIAPSAQKLFSFLKDSNVPLERNPKLKSHAMSVFLMTCESAVQLRKAGKVTVRESSLKKLGASHFKHGVADEHFEVTKFALLETIKEA 128          
BLAST of CX309116 vs. ExPASy Swiss-Prot
Match: HBL1_MEDSA (Non-symbiotic hemoglobin 1 OS=Medicago sativa GN=MHB1 PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 3.433e-55
Identity = 106/122 (86.89%), Postives = 115/122 (94.26%), Query Frame = -2
Query:    1 RAFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKEA 366
            + FTEEQEALVVKSWN MKKN+ ELGLK FL+IFEIAPSAQKLFSFL+DS VPLEQN KLKPHAMSVF+MTCESAVQLRK+GKVTVRES+LKKLGA HFKYGVV+EHFEVTKF+LLETIKEA
Sbjct:    7 KGFTEEQEALVVKSWNAMKKNSAELGLKLFLKIFEIAPSAQKLFSFLKDSKVPLEQNTKLKPHAMSVFLMTCESAVQLRKSGKVTVRESSLKKLGANHFKYGVVDEHFEVTKFALLETIKEA 128          
BLAST of CX309116 vs. ExPASy Swiss-Prot
Match: HBL_TRETO (Non-symbiotic hemoglobin OS=Trema tomentosa GN=GLB1 PE=2 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 7.915e-52
Identity = 102/129 (79.07%), Postives = 116/129 (89.92%), Query Frame = -2
Query:    1 MANINEGRAFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKEA 387
            M++    + FTEEQEALVVKSW VMKKN+ ELGLKFFL+IFEIAPSA+ LFS+L+DS +PLEQN KLKPHAM+VFVMTCESAVQLRKAGKVTVRES LK+LGA+HFK GVVNEHFE T+F+LLETIKEA
Sbjct:    1 MSSSEVDKVFTEEQEALVVKSWAVMKKNSAELGLKFFLKIFEIAPSAKNLFSYLKDSPIPLEQNPKLKPHAMTVFVMTCESAVQLRKAGKVTVRESNLKRLGAIHFKNGVVNEHFE-TRFALLETIKEA 128          
BLAST of CX309116 vs. ExPASy Swiss-Prot
Match: HBPL_PARRI (Non-legume hemoglobin OS=Parasponia rigida PE=1 SV=2)

HSP 1 Score: 200.29 bits (508), Expect = 3.008e-51
Identity = 98/129 (75.97%), Postives = 115/129 (89.15%), Query Frame = -2
Query:    1 MANINEGRAFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKEA 387
            M++    + FTEEQEALVVK+W VMKKN+ ELGL+FFL+IFEIAPSA+ LFS+L+DS VPLEQN KLKPHA +VFVMTCESAVQLRKAGK TV+ES LK++GA+HFK GVVNEHFEVT+F+LLETIKEA
Sbjct:    1 MSSSEVNKVFTEEQEALVVKAWAVMKKNSAELGLQFFLKIFEIAPSAKNLFSYLKDSPVPLEQNPKLKPHATTVFVMTCESAVQLRKAGKATVKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKEA 129          
BLAST of CX309116 vs. ExPASy Swiss-Prot
Match: HBPL_PARAD (Non-legume hemoglobin OS=Parasponia andersonii PE=1 SV=2)

HSP 1 Score: 200.29 bits (508), Expect = 3.008e-51
Identity = 98/129 (75.97%), Postives = 115/129 (89.15%), Query Frame = -2
Query:    1 MANINEGRAFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKEA 387
            M++    + FTEEQEALVVK+W VMKKN+ ELGL+FFL+IFEIAPSA+ LFS+L+DS VPLEQN KLKPHA +VFVMTCESAVQLRKAGK TV+ES LK++GA+HFK GVVNEHFEVT+F+LLETIKEA
Sbjct:    1 MSSSEVNKVFTEEQEALVVKAWAVMKKNSAELGLQFFLKIFEIAPSAKNLFSYLKDSPVPLEQNPKLKPHATTVFVMTCESAVQLRKAGKATVKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKEA 129          
BLAST of CX309116 vs. ExPASy Swiss-Prot
Match: HBL1_ARATH (Non-symbiotic hemoglobin 1 OS=Arabidopsis thaliana GN=AHB1 PE=1 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 2.546e-50
Identity = 98/126 (77.78%), Postives = 113/126 (89.68%), Query Frame = -2
Query:    1 NEGR-AFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKEA 375
            +EG+  FTEEQEALVVKSW+VMKKN+ ELGLK F++IFEIAP+ +K+FSFLRDS +P EQN KLKPHAMSVFVM CESAVQLRK GKVTVRE+TLK+LGA H KYGVV+EHFEV K++LLETIKEA
Sbjct:    3 SEGKIVFTEEQEALVVKSWSVMKKNSAELGLKLFIKIFEIAPTTKKMFSFLRDSPIPAEQNPKLKPHAMSVFVMCCESAVQLRKTGKVTVRETTLKRLGASHSKYGVVDEHFEVAKYALLETIKEA 128          
BLAST of CX309116 vs. ExPASy Swiss-Prot
Match: HBL_MAIZE (Non-symbiotic hemoglobin OS=Zea mays GN=HB PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 6.934e-48
Identity = 94/131 (71.76%), Postives = 114/131 (87.02%), Query Frame = -2
Query:    1 SMANINEGRA-FTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKEA 390
            ++A  ++G   F EEQEALV+KSW VMKK+A  LGL+FFL++FEIAPSA+++FSFLRDS+VPLE+N KLK HAMSVFVMTCE+A QLRKAGKVTVRE+TLK+LGA H +YGV + HFEVT F+LLETIKEA
Sbjct:    2 ALAEADDGAVVFGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEIAPSAEQMFSFLRDSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRETTLKRLGATHLRYGVADGHFEVTGFALLETIKEA 132          
BLAST of CX309116 vs. ExPASy Swiss-Prot
Match: HBL_ZEAMP (Non-symbiotic hemoglobin OS=Zea mays subsp. parviglumis GN=HB PE=1 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 9.056e-48
Identity = 94/131 (71.76%), Postives = 114/131 (87.02%), Query Frame = -2
Query:    1 SMANINEGRA-FTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKEA 390
            ++A  ++G   F EEQEALV+KSW VMKK+A  LGL+FFL++FEIAPSA+++FSFLRDS+VPLE+N KLK HAMSVFVMTCE+A QLRKAGKVTVRE+TLK+LGA H +YGV + HFEVT F+LLETIKEA
Sbjct:    2 ALAEADDGAVVFGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEIAPSAKQMFSFLRDSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRETTLKRLGATHLRYGVADGHFEVTGFALLETIKEA 132          
BLAST of CX309116 vs. ExPASy Swiss-Prot
Match: HBL2_ORYSJ (Non-symbiotic hemoglobin 2 OS=Oryza sativa subsp. japonica GN=HB2 PE=2 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 1.545e-47
Identity = 89/121 (73.55%), Postives = 111/121 (91.74%), Query Frame = -2
Query:    1 AFTEEQEALVVKSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKEA 363
            +F+EEQEALV+KSW +MKK++  +GL+FFL+IFE+APSA ++FSFLR+S+VPLE+N KLK HAMSVFVMTCE+A QLRKAGKVTVR++TLK+LGA HFKYGV + HFEVT+F+LLETIKEA
Sbjct:   16 SFSEEQEALVLKSWAIMKKDSANIGLRFFLKIFEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTLKRLGATHFKYGVGDAHFEVTRFALLETIKEA 136          
The following BLAST results are available for this feature:
BLAST of CX309116 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 50
Match NameE-valueIdentityDescription
HBL1_GOSHI1.261e-5789.52Non-symbiotic hemoglobin 1 OS=Gossypium hirsutum G... [more]
HBP2_CASGL5.297e-5687.10Hemoglobin-2 OS=Casuarina glauca GN=HBII PE=3 SV=1[more]
HBL1_MEDSA3.433e-5586.89Non-symbiotic hemoglobin 1 OS=Medicago sativa GN=M... [more]
HBL_TRETO7.915e-5279.07Non-symbiotic hemoglobin OS=Trema tomentosa GN=GLB... [more]
HBPL_PARRI3.008e-5175.97Non-legume hemoglobin OS=Parasponia rigida PE=1 SV... [more]
HBPL_PARAD3.008e-5175.97Non-legume hemoglobin OS=Parasponia andersonii PE=... [more]
HBL1_ARATH2.546e-5077.78Non-symbiotic hemoglobin 1 OS=Arabidopsis thaliana... [more]
HBL_MAIZE6.934e-4871.76Non-symbiotic hemoglobin OS=Zea mays GN=HB PE=2 SV... [more]
HBL_ZEAMP9.056e-4871.76Non-symbiotic hemoglobin OS=Zea mays subsp. parvig... [more]
HBL2_ORYSJ1.545e-4773.55Non-symbiotic hemoglobin 2 OS=Oryza sativa subsp. ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21008G03Rv AbsLeaSub1 Citrus clementina cDNA clone C21008G03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX309116 ID=CX309116|Name=CX309116|organism=Citrus clementina|type=EST|length=445bp
TGCCTCTTTTATGGTTTCCAGTAGTGAAAATTTTGTGACCTCAAAATGCT
CATTAACAACACCATATTTGAAGTGGACAGCTCCTAATTTTTTTAGAGTT
GATTCTCTTACTGTCACTTTGCCTGCTTTCCTCAGTTGCACTGCTGATTC
ACACGTCATAACAAAAACAGACATGGCGTGGGGCTTGAGCTTCTGGTTCT
GCTCTAGAGGCACATTTGAGTCTCTCAAGAATGAGAACAGCTTTTGGGCT
GATGGTGCAATCTCAAAGATCCTCAAGAAGAATTTAAGACCCAATTCTCC
AGCATTCTTCTTCATTACATTCCATGACTTGACAACTAAAGCTTCTTGCT
CTTCAGTAAAGGCTCTACCTTCGTTAATGTTGGCCATTGATTTCTTTTGG
ACACCTGAGGATTGAATGTGATACACAAAATGTTGTTGAATCCCG
back to top