CX309122

Overview
NameCX309122
Unique NameCX309122
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length435
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig768 contig Ccv1_Contig768:786..1220. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX309122 vs. ExPASy Swiss-Prot
Match: ATG8D_ARATH (Autophagy-related protein 8d OS=Arabidopsis thaliana GN=ATG8D PE=1 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 6.276e-35
Identity = 70/76 (92.11%), Postives = 76/76 (100.00%), Query Frame = 3
Query:    3 EIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNILPPTAAMMSAIYEENRDEDGFLYMTYSGENTFGIF 230
            +ID+KKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNILPPTAA+MSAIYEE++DEDGFLYM+YSGENTFGIF
Sbjct:   44 DIDRKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNILPPTAAIMSAIYEEHKDEDGFLYMSYSGENTFGIF 119          
BLAST of CX309122 vs. ExPASy Swiss-Prot
Match: ATG8B_ORYSJ (Autophagy-related protein 8B OS=Oryza sativa subsp. japonica GN=ATG8B PE=3 SV=2)

HSP 1 Score: 145.976 bits (367), Expect = 6.276e-35
Identity = 70/75 (93.33%), Postives = 74/75 (98.67%), Query Frame = 3
Query:    3 EIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNILPPTAAMMSAIYEENRDEDGFLYMTYSGENTFGI 227
            +IDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKN LPPTAA+MSAIYEEN+DEDGFLYMTYSGENTFG+
Sbjct:   44 DIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNTLPPTAALMSAIYEENKDEDGFLYMTYSGENTFGL 118          
BLAST of CX309122 vs. ExPASy Swiss-Prot
Match: ATG8B_ORYSI (Autophagy-related protein 8B OS=Oryza sativa subsp. indica GN=ATG8B PE=3 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 6.276e-35
Identity = 70/75 (93.33%), Postives = 74/75 (98.67%), Query Frame = 3
Query:    3 EIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNILPPTAAMMSAIYEENRDEDGFLYMTYSGENTFGI 227
            +IDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKN LPPTAA+MSAIYEEN+DEDGFLYMTYSGENTFG+
Sbjct:   44 DIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNTLPPTAALMSAIYEENKDEDGFLYMTYSGENTFGL 118          
BLAST of CX309122 vs. ExPASy Swiss-Prot
Match: ATG8C_ORYSJ (Autophagy-related protein 8C OS=Oryza sativa subsp. japonica GN=ATG8C PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 1.071e-34
Identity = 70/76 (92.11%), Postives = 74/76 (97.37%), Query Frame = 3
Query:    3 EIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNILPPTAAMMSAIYEENRDEDGFLYMTYSGENTFGIF 230
            +IDKKKYLVPADLTVGQFVYVVRKRIKLS EKAIFIFVKN LPPTAA+MSAIYEEN+DEDGFLYMTYSGENTFG+F
Sbjct:   44 DIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFVKNTLPPTAALMSAIYEENKDEDGFLYMTYSGENTFGLF 119          
BLAST of CX309122 vs. ExPASy Swiss-Prot
Match: ATG8C_ORYSI (Autophagy-related protein 8C OS=Oryza sativa subsp. indica GN=ATG8C PE=3 SV=2)

HSP 1 Score: 145.206 bits (365), Expect = 1.071e-34
Identity = 70/76 (92.11%), Postives = 74/76 (97.37%), Query Frame = 3
Query:    3 EIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNILPPTAAMMSAIYEENRDEDGFLYMTYSGENTFGIF 230
            +IDKKKYLVPADLTVGQFVYVVRKRIKLS EKAIFIFVKN LPPTAA+MSAIYEEN+DEDGFLYMTYSGENTFG+F
Sbjct:   44 DIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFVKNTLPPTAALMSAIYEENKDEDGFLYMTYSGENTFGLF 119          
BLAST of CX309122 vs. ExPASy Swiss-Prot
Match: ATG8A_ORYSJ (Autophagy-related protein 8A OS=Oryza sativa subsp. japonica GN=ATG8A PE=3 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 1.398e-34
Identity = 69/74 (93.24%), Postives = 73/74 (98.65%), Query Frame = 3
Query:    3 EIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNILPPTAAMMSAIYEENRDEDGFLYMTYSGENTFG 224
            EIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIF+FVKN LPPTA++MSAIYEEN+DEDGFLYMTYSGENTFG
Sbjct:   44 EIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFVFVKNTLPPTASLMSAIYEENKDEDGFLYMTYSGENTFG 117          
BLAST of CX309122 vs. ExPASy Swiss-Prot
Match: ATG8A_ORYSI (Autophagy-related protein 8A OS=Oryza sativa subsp. indica GN=ATG8A PE=1 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 1.398e-34
Identity = 69/74 (93.24%), Postives = 73/74 (98.65%), Query Frame = 3
Query:    3 EIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNILPPTAAMMSAIYEENRDEDGFLYMTYSGENTFG 224
            EIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIF+FVKN LPPTA++MSAIYEEN+DEDGFLYMTYSGENTFG
Sbjct:   44 EIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFVFVKNTLPPTASLMSAIYEENKDEDGFLYMTYSGENTFG 117          
BLAST of CX309122 vs. ExPASy Swiss-Prot
Match: ATG8C_ARATH (Autophagy-related protein 8c OS=Arabidopsis thaliana GN=ATG8C PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.184e-33
Identity = 68/74 (91.89%), Postives = 72/74 (97.30%), Query Frame = 3
Query:    6 IDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNILPPTAAMMSAIYEENRDEDGFLYMTYSGENTFGI 227
            IDKKKYLVPADLTVGQFVYVVRKRIKLS EKAIF+FVKN LPPTAAMMSAIY+EN+DEDGFLYMTYSGENTFG+
Sbjct:   45 IDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFVFVKNTLPPTAAMMSAIYDENKDEDGFLYMTYSGENTFGL 118          
BLAST of CX309122 vs. ExPASy Swiss-Prot
Match: ATG8A_ARATH (Autophagy-related protein 8a OS=Arabidopsis thaliana GN=ATG8A PE=1 SV=2)

HSP 1 Score: 138.272 bits (347), Expect = 1.309e-32
Identity = 66/74 (89.19%), Postives = 71/74 (95.95%), Query Frame = 3
Query:    3 EIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNILPPTAAMMSAIYEENRDEDGFLYMTYSGENTFG 224
            +IDKKKYLVPADLTVGQFVYVVRKRIKL  EKAIF+FVKN LPPTAA+MSAIYEE++DEDGFLYMTYSGENTFG
Sbjct:   44 DIDKKKYLVPADLTVGQFVYVVRKRIKLGAEKAIFVFVKNTLPPTAALMSAIYEEHKDEDGFLYMTYSGENTFG 117          
BLAST of CX309122 vs. ExPASy Swiss-Prot
Match: ATG8B_ARATH (Autophagy-related protein 8b OS=Arabidopsis thaliana GN=ATG8B PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.709e-32
Identity = 65/74 (87.84%), Postives = 71/74 (95.95%), Query Frame = 3
Query:    3 EIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNILPPTAAMMSAIYEENRDEDGFLYMTYSGENTFG 224
            +IDKKKYLVPADLT+GQFVYVVRKRIKL  EKAIF+FVKN LPPTAA+MSAIYEE++DEDGFLYMTYSGENTFG
Sbjct:   44 DIDKKKYLVPADLTIGQFVYVVRKRIKLGAEKAIFVFVKNTLPPTAALMSAIYEEHKDEDGFLYMTYSGENTFG 117          
The following BLAST results are available for this feature:
BLAST of CX309122 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 80
Match NameE-valueIdentityDescription
ATG8D_ARATH6.276e-3592.11Autophagy-related protein 8d OS=Arabidopsis thalia... [more]
ATG8B_ORYSJ6.276e-3593.33Autophagy-related protein 8B OS=Oryza sativa subsp... [more]
ATG8B_ORYSI6.276e-3593.33Autophagy-related protein 8B OS=Oryza sativa subsp... [more]
ATG8C_ORYSJ1.071e-3492.11Autophagy-related protein 8C OS=Oryza sativa subsp... [more]
ATG8C_ORYSI1.071e-3492.11Autophagy-related protein 8C OS=Oryza sativa subsp... [more]
ATG8A_ORYSJ1.398e-3493.24Autophagy-related protein 8A OS=Oryza sativa subsp... [more]
ATG8A_ORYSI1.398e-3493.24Autophagy-related protein 8A OS=Oryza sativa subsp... [more]
ATG8C_ARATH1.184e-3391.89Autophagy-related protein 8c OS=Arabidopsis thalia... [more]
ATG8A_ARATH1.309e-3289.19Autophagy-related protein 8a OS=Arabidopsis thalia... [more]
ATG8B_ARATH1.709e-3287.84Autophagy-related protein 8b OS=Arabidopsis thalia... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21008G09Rv AbsLeaSub1 Citrus clementina cDNA clone C21008G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX309122 ID=CX309122|Name=CX309122|organism=Citrus clementina|type=EST|length=435bp
TTGAAATTGACAAGAAGAAATATCTGGTTCCTGCTGATCTGACTGTTGGC
CAGTTTGTGTATGTGGTGCGAAAGAGGATCAAGCTCAGTCCTGAGAAGGC
TATTTTCATTTTTGTGAAAAACATTCTGCCACCCACTGCGGCAATGATGT
CTGCCATATATGAGGAAAACAGGGATGAAGATGGCTTCCTTTACATGACC
TACAGTGGGGAGAATACATTTGGGATCTTCTGAAGTGTGATCAAGCTACT
ATTATGTGAATAATGCTTCAAGAAGTTAGGTGAAGAAGGGGTTAAGTTGT
AAATAGTTCTATGTTCCATTAGTTTGGAATTTCTTTTAGTTAATGGTATT
ATATGTAACAACCTAAAAGTTGGGATCAGCAACTATTTACATAAAATTCA
ATAGTTTTCTCGAAAAAAAAAAAAAAAAAAAAAAA
back to top