CX309127

Overview
NameCX309127
Unique NameCX309127
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length335
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig952 contig Ccv1_Contig952:1141..1475. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX309127 vs. ExPASy Swiss-Prot
Match: INO1_SESIN (Inositol-3-phosphate synthase OS=Sesamum indicum PE=2 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 4.479e-56
Identity = 106/111 (95.50%), Postives = 109/111 (98.20%), Query Frame = 2
Query:    2 GLIDLAIRRNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNGILYGPGEHPDHVVVIKYVPYVGDSKRAMD 334
            GLIDLAI+RN LIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMV+SNGILY PGEHPDH+VVIKYVPYVGDSKRAMD
Sbjct:  290 GLIDLAIQRNSLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVASNGILYEPGEHPDHIVVIKYVPYVGDSKRAMD 400          
BLAST of CX309127 vs. ExPASy Swiss-Prot
Match: INO1_TOBAC (Inositol-3-phosphate synthase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 5.850e-56
Identity = 107/111 (96.40%), Postives = 108/111 (97.30%), Query Frame = 2
Query:    2 GLIDLAIRRNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNGILYGPGEHPDHVVVIKYVPYVGDSKRAMD 334
            GLIDLAI+RN LIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSN ILY PGEHPDHVVVIKYVPYVGDSKRAMD
Sbjct:  290 GLIDLAIKRNTLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNAILYEPGEHPDHVVVIKYVPYVGDSKRAMD 400          
BLAST of CX309127 vs. ExPASy Swiss-Prot
Match: INO1_MESCR (Inositol-3-phosphate synthase OS=Mesembryanthemum crystallinum PE=2 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 5.850e-56
Identity = 106/111 (95.50%), Postives = 109/111 (98.20%), Query Frame = 2
Query:    2 GLIDLAIRRNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNGILYGPGEHPDHVVVIKYVPYVGDSKRAMD 334
            GLIDLAI++N LIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMV+SNGILY PGEHPDHVVVIKYVPYVGDSKRAMD
Sbjct:  292 GLIDLAIKKNSLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVASNGILYEPGEHPDHVVVIKYVPYVGDSKRAMD 402          
BLAST of CX309127 vs. ExPASy Swiss-Prot
Match: INO1_MAIZE (Inositol-3-phosphate synthase OS=Zea mays PE=2 SV=2)

HSP 1 Score: 215.698 bits (548), Expect = 5.850e-56
Identity = 106/111 (95.50%), Postives = 107/111 (96.40%), Query Frame = 2
Query:    2 GLIDLAIRRNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNGILYGPGEHPDHVVVIKYVPYVGDSKRAMD 334
            GLIDLAI+ NCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQ FRSKEISKSNVVDDMVSSN ILY PGEHPDHVVVIKYVPYVGDSKRAMD
Sbjct:  290 GLIDLAIKNNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQAFRSKEISKSNVVDDMVSSNAILYEPGEHPDHVVVIKYVPYVGDSKRAMD 400          
BLAST of CX309127 vs. ExPASy Swiss-Prot
Match: INO1_HORVU (Inositol-3-phosphate synthase OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 5.850e-56
Identity = 106/111 (95.50%), Postives = 108/111 (97.30%), Query Frame = 2
Query:    2 GLIDLAIRRNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNGILYGPGEHPDHVVVIKYVPYVGDSKRAMD 334
            GLIDLAI+ +CLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSN ILY PGEHPDHVVVIKYVPYVGDSKRAMD
Sbjct:  290 GLIDLAIKNDCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNAILYEPGEHPDHVVVIKYVPYVGDSKRAMD 400          
BLAST of CX309127 vs. ExPASy Swiss-Prot
Match: INO3_ARATH (Probable inositol-3-phosphate synthase isozyme 3 OS=Arabidopsis thaliana GN=At5g10170 PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 7.640e-56
Identity = 106/111 (95.50%), Postives = 108/111 (97.30%), Query Frame = 2
Query:    2 GLIDLAIRRNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNGILYGPGEHPDHVVVIKYVPYVGDSKRAMD 334
            GLI+LAI+RNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMV SNGILY PGEHPDHVVVIKYVP VGDSKRAMD
Sbjct:  290 GLIELAIKRNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVGSNGILYEPGEHPDHVVVIKYVPCVGDSKRAMD 400          
BLAST of CX309127 vs. ExPASy Swiss-Prot
Match: INO1_WHEAT (Inositol-3-phosphate synthase OS=Triticum aestivum GN=MIPS PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 7.640e-56
Identity = 105/111 (94.59%), Postives = 109/111 (98.20%), Query Frame = 2
Query:    2 GLIDLAIRRNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNGILYGPGEHPDHVVVIKYVPYVGDSKRAMD 334
            GLI+LAI +NCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMV+SNGIL+ PGEHPDHVVVIKYVPYVGDSKRAMD
Sbjct:  290 GLIELAISKNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVASNGILFEPGEHPDHVVVIKYVPYVGDSKRAMD 400          
BLAST of CX309127 vs. ExPASy Swiss-Prot
Match: INO1_SPIPO (Inositol-3-phosphate synthase OS=Spirodela polyrrhiza GN=TUR1 PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 7.640e-56
Identity = 105/111 (94.59%), Postives = 109/111 (98.20%), Query Frame = 2
Query:    2 GLIDLAIRRNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNGILYGPGEHPDHVVVIKYVPYVGDSKRAMD 334
            GLI++AI+RN LIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNGILY PGEHPDHV+VIKYVPYVGDSKRAMD
Sbjct:  290 GLIEMAIKRNSLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNGILYEPGEHPDHVIVIKYVPYVGDSKRAMD 400          
BLAST of CX309127 vs. ExPASy Swiss-Prot
Match: INO1_NICPA (Inositol-3-phosphate synthase OS=Nicotiana paniculata GN=INPS1 PE=2 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 1.303e-55
Identity = 106/111 (95.50%), Postives = 108/111 (97.30%), Query Frame = 2
Query:    2 GLIDLAIRRNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNGILYGPGEHPDHVVVIKYVPYVGDSKRAMD 334
            GLIDLAI++N LIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSN ILY PGEHPDHVVVIKYVPYVGDSKRAMD
Sbjct:  290 GLIDLAIKKNTLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNAILYEPGEHPDHVVVIKYVPYVGDSKRAMD 400          
BLAST of CX309127 vs. ExPASy Swiss-Prot
Match: INO1_ORYSJ (Inositol-3-phosphate synthase OS=Oryza sativa subsp. japonica GN=INO1 PE=2 SV=2)

HSP 1 Score: 213.772 bits (543), Expect = 2.223e-55
Identity = 106/111 (95.50%), Postives = 107/111 (96.40%), Query Frame = 2
Query:    2 GLIDLAIRRNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNGILYGPGEHPDHVVVIKYVPYVGDSKRAMD 334
            GLIDLAI+ NCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSN ILY  GEHPDHVVVIKYVPYVGDSKRAMD
Sbjct:  290 GLIDLAIKNNCLIGGDDFKSGQTKMKSVLVDFLVGAGIKPTSIVSYNHLGNNDGMNLSAPQTFRSKEISKSNVVDDMVSSNAILYELGEHPDHVVVIKYVPYVGDSKRAMD 400          
The following BLAST results are available for this feature:
BLAST of CX309127 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
INO1_SESIN4.479e-5695.50Inositol-3-phosphate synthase OS=Sesamum indicum P... [more]
INO1_TOBAC5.850e-5696.40Inositol-3-phosphate synthase OS=Nicotiana tabacum... [more]
INO1_MESCR5.850e-5695.50Inositol-3-phosphate synthase OS=Mesembryanthemum ... [more]
INO1_MAIZE5.850e-5695.50Inositol-3-phosphate synthase OS=Zea mays PE=2 SV=... [more]
INO1_HORVU5.850e-5695.50Inositol-3-phosphate synthase OS=Hordeum vulgare P... [more]
INO3_ARATH7.640e-5695.50Probable inositol-3-phosphate synthase isozyme 3 O... [more]
INO1_WHEAT7.640e-5694.59Inositol-3-phosphate synthase OS=Triticum aestivum... [more]
INO1_SPIPO7.640e-5694.59Inositol-3-phosphate synthase OS=Spirodela polyrrh... [more]
INO1_NICPA1.303e-5595.50Inositol-3-phosphate synthase OS=Nicotiana panicul... [more]
INO1_ORYSJ2.223e-5595.50Inositol-3-phosphate synthase OS=Oryza sativa subs... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21008H02Rv AbsLeaSub1 Citrus clementina cDNA clone C21008H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX309127 ID=CX309127|Name=CX309127|organism=Citrus clementina|type=EST|length=335bp
AGGGCTTATTGACTTGGCTATTAGGAGGAACTGTTTGATTGGTGGAGATG
ACTTCAAGAGTGGGCAGACTAAGATGAAATCTGTTTTGGTTGATTTCCTT
GTTGGGGCAGGAATCAAGCCAACATCAATTGTTAGCTACAACCACTTGGG
AAACAATGATGGAATGAATCTTTCAGCCCCTCAAACCTTCCGCTCCAAGG
AGATTTCCAAAAGTAATGTTGTTGATGACATGGTCTCCAGCAATGGTATC
CTTTATGGGCCTGGTGAACACCCCGACCACGTTGTGGTCATCAAGTATGT
GCCATATGTTGGCGATAGCAAGAGAGCCATGGATG
back to top