DY258025

Overview
NameDY258025
Unique NameDY258025
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length744
Libraries
Library NameType
AbsCOv1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DY258025 vs. ExPASy Swiss-Prot
Match: SRP19_ARATH (Signal recognition particle 19 kDa protein OS=Arabidopsis thaliana GN=SRP19 PE=2 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 3.302e-48
Identity = 88/115 (76.52%), Postives = 101/115 (87.83%), Query Frame = 1
Query:  121 MDAQTARIKKWVILYPVYINSKKTIAEGRRISASKACENPTCIEIADCCQYLKIPHAIEIDKAYPRDFMQRGRVRVMLKREDGTFVNPAISSRKQLMLHVAELVPRHPNRTKKQE 465
            MD+ T  IKKWV++YPVYINSKKT+AEGRRIS SK+CENP CIEI+DCC++LK+P A+EIDKAYPRDFMQ GRVRV LKREDGT +NPAI+SRK LM  +AELVPRHP R KKQE
Sbjct:    1 MDSGTINIKKWVVIYPVYINSKKTVAEGRRISVSKSCENPNCIEISDCCKHLKLPSAVEIDKAYPRDFMQVGRVRVQLKREDGTLLNPAITSRKHLMQKIAELVPRHPERVKKQE 115          
BLAST of DY258025 vs. ExPASy Swiss-Prot
Match: SRP19_ORYSJ (Signal recognition particle 19 kDa protein OS=Oryza sativa subsp. japonica GN=SRP19 PE=1 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 5.829e-45
Identity = 80/112 (71.43%), Postives = 100/112 (89.29%), Query Frame = 1
Query:  142 IKKWVILYPVYINSKKTIAEGRRISASKACENPTCIEIADCCQYLKIPHAIEIDKAYPRDFMQRGRVRVMLKREDGTFVNPAISSRKQLMLHVAELVPRHPNRTKKQEPAST 477
            IKKW ++YPVY+NSKKT+AEGRRI++ KAC +PTC+EIADCC +LKIPHAIE+DKAYPRDF Q GRVRV LK++DG+ VNPAI ++KQLM+ +AELVP+H  RTKKQEPA++
Sbjct:   10 IKKWNVIYPVYLNSKKTVAEGRRIASGKACPDPTCVEIADCCSHLKIPHAIELDKAYPRDFFQVGRVRVQLKKDDGSPVNPAIKTKKQLMIQIAELVPKHHGRTKKQEPAAS 121          
BLAST of DY258025 vs. ExPASy Swiss-Prot
Match: SRP19_MOUSE (Signal recognition particle 19 kDa protein OS=Mus musculus GN=Srp19 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.635e-21
Identity = 53/108 (49.07%), Postives = 71/108 (65.74%), Query Frame = 1
Query:  148 KWVILYPVYINSKKTIAEGRRISASKACENPTCIEIADCCQYLKIPHAIEIDKAYP----RDFMQRGRVRVMLKREDGTFVNPAISSRKQLMLHVAELVPRHPNRTKK 459
            +++ +YP Y+N+KKTIAEGRRI  SKA ENPT  EI D C  + +   +E +K Y     RD   RGRVRV LK+EDG+       SRK +ML+VAE++P+   RT+K
Sbjct:   14 RFIFIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNAFLEKNKMYSREWNRDVQFRGRVRVQLKQEDGSLCLVQFPSRKSVMLYVAEMIPKLKTRTQK 121          
BLAST of DY258025 vs. ExPASy Swiss-Prot
Match: SRP19_PONAB (Signal recognition particle 19 kDa protein OS=Pongo abelii GN=SRP19 PE=2 SV=2)

HSP 1 Score: 100.908 bits (250), Expect = 7.666e-21
Identity = 52/108 (48.15%), Postives = 70/108 (64.81%), Query Frame = 1
Query:  148 KWVILYPVYINSKKTIAEGRRISASKACENPTCIEIADCCQYLKIPHAIEIDKAYP----RDFMQRGRVRVMLKREDGTFVNPAISSRKQLMLHVAELVPRHPNRTKK 459
            +++ +YP Y+N+KKTIAEGRRI  SKA ENPT  EI D C  + +   +E +K Y     RD   RGRVRV LK+EDG+       SRK +ML+ AE++P+   RT+K
Sbjct:   14 RFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQK 121          
BLAST of DY258025 vs. ExPASy Swiss-Prot
Match: SRP19_HUMAN (Signal recognition particle 19 kDa protein OS=Homo sapiens GN=SRP19 PE=1 SV=3)

HSP 1 Score: 100.908 bits (250), Expect = 7.666e-21
Identity = 52/108 (48.15%), Postives = 70/108 (64.81%), Query Frame = 1
Query:  148 KWVILYPVYINSKKTIAEGRRISASKACENPTCIEIADCCQYLKIPHAIEIDKAYP----RDFMQRGRVRVMLKREDGTFVNPAISSRKQLMLHVAELVPRHPNRTKK 459
            +++ +YP Y+N+KKTIAEGRRI  SKA ENPT  EI D C  + +   +E +K Y     RD   RGRVRV LK+EDG+       SRK +ML+ AE++P+   RT+K
Sbjct:   14 RFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQK 121          
BLAST of DY258025 vs. ExPASy Swiss-Prot
Match: SRP19_BOVIN (Signal recognition particle 19 kDa protein OS=Bos taurus GN=SRP19 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 7.666e-21
Identity = 52/108 (48.15%), Postives = 70/108 (64.81%), Query Frame = 1
Query:  148 KWVILYPVYINSKKTIAEGRRISASKACENPTCIEIADCCQYLKIPHAIEIDKAYP----RDFMQRGRVRVMLKREDGTFVNPAISSRKQLMLHVAELVPRHPNRTKK 459
            +++ +YP Y+N+KKTIAEGRRI  SKA ENPT  EI D C  + +   +E +K Y     RD   RGRVRV LK+EDG+       SRK +ML+ AE++P+   RT+K
Sbjct:   14 RFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCAAVGLNVFLEKNKMYSREWNRDLQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQK 121          
BLAST of DY258025 vs. ExPASy Swiss-Prot
Match: SRP19_CAEEL (Probable signal recognition particle 19 kDa protein OS=Caenorhabditis elegans GN=F37F2.2 PE=2 SV=3)

HSP 1 Score: 82.4185 bits (202), Expect = 2.821e-15
Identity = 44/106 (41.51%), Postives = 63/106 (59.43%), Query Frame = 1
Query:  145 KKWVILYPVYINSKKTIAEGRRISASKACENPTCIEIADCCQYLKIPHAIEIDKAYP----RDFMQRGRVRVMLKREDGTFVNPAISSRKQLMLHVAELVPRHPNR 450
            K+W+++YP YI+ KKT  +GR+IS   A ENPT +EI D    +     +E  K YP    RDF  +GRVRV LK +DGT  +    +R ++   VAE++P+   R
Sbjct:   13 KRWIVIYPAYIDKKKTAKQGRKISQILAVENPTSVEIHDVLAAVGFNPLLERTKCYPRDGERDFEVQGRVRVQLKNDDGTAKHEQ-KTRDEIFKMVAEMIPKLKTR 117          
BLAST of DY258025 vs. ExPASy Swiss-Prot
Match: SEC65_DEBHA (Signal recognition particle SEC65 subunit OS=Debaryomyces hansenii GN=SEC65 PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.685e-15
Identity = 39/117 (33.33%), Postives = 69/117 (58.97%), Query Frame = 1
Query:  130 QTARIKKWVILYPVYINSKKTIAEGRRISASKACENPTCIEIADCCQYLKIPHAIEIDKAYPRDFMQRGRVRVMLK--REDGTFVNPAISSRKQLMLHVAELVPRHPNRTKKQEPAS 474
            + A +KK+ I+YP Y +  ++  +GRR+S SKA  NP    I+D C++  +P  +E+DK +P+DF   GRVRV++K   ++G  V+    +++ ++  +A+ +  HP       P S
Sbjct:   80 ERAELKKFQIIYPCYFDKSRSHKDGRRVSESKAVSNPLAKTISDACRHYNLPVMLELDKTHPQDFGNPGRVRVLIKDNNKNGMPVDSRFKTKRAVLNIIADYLKTHPTTLASIGPKS 196          
BLAST of DY258025 vs. ExPASy Swiss-Prot
Match: SEC65_CANAL (Signal recognition particle SEC65 subunit OS=Candida albicans GN=SEC65 PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.685e-15
Identity = 38/119 (31.93%), Postives = 69/119 (57.98%), Query Frame = 1
Query:  124 DAQTARIKKWVILYPVYINSKKTIAEGRRISASKACENPTCIEIADCCQYLKIPHAIEIDKAYPRDFMQRGRVRVMLKR--EDGTFVNPAISSRKQLMLHVAELVPRHPNRTKKQEPAS 474
            + +  +  ++ I+YP Y +  ++  +GRR+S  +A ENP    I+D C+ L +P  +E+DK +P+DF   GRV+V+ K   ++G  +NP + +++ L   +AE +  HP   +   P S
Sbjct:   84 EEEKKQFDQFQIIYPCYFDINRSHKQGRRVSIDRAVENPLATTISDACRRLGLPVFLELDKTHPQDFGNPGRVKVLFKAVFDNGKLINPKLQTKRVLFNVIAEYLSEHPTTLESIGPKS 202          
BLAST of DY258025 vs. ExPASy Swiss-Prot
Match: SEC65_YARLI (Signal recognition particle SEC65 subunit OS=Yarrowia lipolytica GN=SEC65 PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.813e-15
Identity = 39/110 (35.45%), Postives = 62/110 (56.36%), Query Frame = 1
Query:  124 DAQTARIKKWVILYPVYINSKKTIAEGRRISASKACENPTCIEIADCCQYLKIPHAIEIDKAYPRDFMQRGRVRVMLKREDGTFVNP-AISSRKQLMLHVAELVPRHPNR 450
            + Q +  K W I+YPVY +  KT+ EGRR+    A ENP    IA+ C+ L +P   E  K +P+D+   GRVRV LK +    + P ++ +++ L   +A+ +  HP +
Sbjct:  112 EIQESDFKDWQIVYPVYFDKNKTVGEGRRVPLELAVENPLGQTIAEACKMLTLPSIYEAHKTHPKDWANPGRVRVQLKDDPALGLPPHSVKNKRHLFRLIAQYMKEHPTK 221          
The following BLAST results are available for this feature:
BLAST of DY258025 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
SRP19_ARATH3.302e-4876.52Signal recognition particle 19 kDa protein OS=Arab... [more]
SRP19_ORYSJ5.829e-4571.43Signal recognition particle 19 kDa protein OS=Oryz... [more]
SRP19_MOUSE2.635e-2149.07Signal recognition particle 19 kDa protein OS=Mus ... [more]
SRP19_PONAB7.666e-2148.15Signal recognition particle 19 kDa protein OS=Pong... [more]
SRP19_HUMAN7.666e-2148.15Signal recognition particle 19 kDa protein OS=Homo... [more]
SRP19_BOVIN7.666e-2148.15Signal recognition particle 19 kDa protein OS=Bos ... [more]
SRP19_CAEEL2.821e-1541.51Probable signal recognition particle 19 kDa protei... [more]
SEC65_DEBHA3.685e-1533.33Signal recognition particle SEC65 subunit OS=Debar... [more]
SEC65_CANAL3.685e-1531.93Signal recognition particle SEC65 subunit OS=Candi... [more]
SEC65_YARLI4.813e-1535.45Signal recognition particle SEC65 subunit OS=Yarro... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAB2CG03ZM1 AbsCOv1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY258025 ID=DY258025; Name=DY258025; organism=Citrus clementina; type=EST; length=744bp
GAGAGGAATGTTTAATTTTTTTTGACAAAATATAAAAATACAACATAAAT
TAACGCCTGTTTCGTTCCTACTGAAGAACAGCAAAGGATCAAGGGTTTAT
ATCAGATTTGGATAGGAGAGATGGATGCGCAAACAGCTCGTATAAAGAAG
TGGGTAATATTGTATCCCGTTTACATAAATTCAAAGAAAACTATTGCTGA
AGGAAGGCGTATTAGCGCCAGCAAAGCATGTGAAAACCCCACTTGTATCG
AAATTGCTGATTGTTGTCAGTATTTGAAAATCCCTCACGCCATTGAGATT
GATAAGGCCTATCCACGGGATTTTATGCAAAGAGGTAGAGTGAGGGTGAT
GCTGAAAAGGGAAGATGGGACTTTTGTCAATCCAGCCATTTCTTCAAGGA
AACAGCTGATGCTTCATGTTGCAGAATTGGTACCAAGACATCCTAATAGG
ACTAAGAAGCAAGAGCCTGCATCCACATCTTCAAATGCCGGTCCCTCCAA
ATCCGGGAAAGGTGGAAAAAAGAAGAGATAGATTTAGCATTCCATATGTA
TTGAATCCAAAGTTATTGTTCTTGTTGCCCAATTCCCCCAAACGTTCCCT
TTCTTCAGTTGTAACATTCTTGTTGGTTGGTTTACCTTAGTTGTTTTCAG
AAGAGTTCATTTCAGCCGACAACTTTTAACTTTGGAAACCTTTAAAATAC
TCTTTGGATTCTTCATTATCAGTTTACATGTAATCCATTTAGTG
back to top