DY258033

Overview
NameDY258033
Unique NameDY258033
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1245
Libraries
Library NameType
AbsCOv1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DY258033 vs. ExPASy Swiss-Prot
Match: DME_ARATH (Transcriptional activator DEMETER OS=Arabidopsis thaliana GN=DME PE=1 SV=2)

HSP 1 Score: 358.607 bits (919), Expect = 4.362e-98
Identity = 184/357 (51.54%), Postives = 229/357 (64.15%), Query Frame = 2
Query:    2 ECVRLLSLQHIAFPVDVNVGRIAVRLGWVPLQPLPGDLHIHLLKEYPVVDKIQMYLWPRLCYLDQKTLYELHYQMITFGKIFCKKRSPNCGACPLRGECKHFASAVASARFALPGPS*KGIVTSEFGNGIGQSPPLVVNPIPV-IRIEADPVSESGYQINNCEPIIEEPRSPGPQCXXXXXXXXXXXXXXXXXXXXXPTLRLQEREFKENFPNFMEMNKVMLQD--SSALVALTAEAASVPTRKLKRCAHLRTEHHVYVLPDAHELLRGFDRRDPDDPSPYLLAIWSPGESQNSVGSPQYRCNSKDS-KLCNSEICYSCNIVCKRNAGIVRGTILIPCRIANKGKISFNGNILFQVN 1060
            ECVRLL+L ++AFPVD NVGRIAVR+GWVPLQPLP  L +HLL+ YPV++ IQ +LWPRLC LDQ+TLYELHYQ+ITFGK+FC K  PNC ACP+RGEC+HFASA ASAR ALP P  + + ++         PP+ +  I + + +E    S +     NCEPIIEEP SPG +C                     PT++L   +F       ME N  + +   S ALVAL     S+PT KLK  + LRTEH VY LPD+H LL G D+R+PDDPSPYLLAIW+PGE+ NS   P+ +C  K S K+C  E C  CN + + N+  VRGT+LIPCR A +G    NG   FQVN
Sbjct: 1547 ECVRLLTLHNLAFPVDTNVGRIAVRMGWVPLQPLPESLQLHLLELYPVLESIQKFLWPRLCKLDQRTLYELHYQLITFGKVFCTKSRPNCNACPMRGECRHFASAYASARLALPAPEERSLTSATIPVPPESYPPVAIPMIELPLPLEKSLASGAPSNRENCEPIIEEPASPGQEC-TEITESDIEDAYYNEDPDEIPTIKLNIEQFGMTLREHMERNMELQEGDMSKALVALHPTTTSIPTPKLKNISRLRTEHQVYELPDSHRLLDGMDKREPDDPSPYLLAIWTPGETANSAQPPEQKCGGKASGKMCFDETCSECNSLREANSQTVRGTLLIPCRTAMRGSFPLNGT-YFQVN 1901          
BLAST of DY258033 vs. ExPASy Swiss-Prot
Match: ROS1_ARATH (Protein ROS1 OS=Arabidopsis thaliana GN=ROS1 PE=1 SV=2)

HSP 1 Score: 353.599 bits (906), Expect = 1.403e-96
Identity = 194/361 (53.74%), Postives = 230/361 (63.71%), Query Frame = 2
Query:    2 ECVRLLSLQHIAFPVDVNVGRIAVRLGWVPLQPLPGDLHIHLLKEYPVVDKIQMYLWPRLCYLDQKTLYELHYQMITFGKIFCKKRSPNCGACPLRGECKHFASAVASARFALPGPS*KGIVTSEFGNGIGQSPPLVVN-PIPVIRIEADPV---SESGYQINNCEPIIEEPRSPGPQCXXXXXXXXXXXXXXXXXXXXXPTLRLQEREFKENFPNFMEMNKVMLQD---SSALVALTAEAASVPTRKLKRCAHLRTEHHVYVLPDAHELLRGFDRRDPDDPSPYLLAIWSPGESQNSVGSPQYRC-NSKDSKLCNSEICYSCNIVCKRNAGIVRGTILIPCRIANKGKISFNGNILFQVN 1060
            ECVRLL+L H+AFPVD NVGRIAVRLGWVPLQPLP  L +HLL+ YP+++ IQ YLWPRLC LDQKTLYELHYQMITFGK+FC K  PNC ACP++GEC+HFASA ASAR ALP        ++E G G     PL ++ P P  R +   V   SE   ++  CEPIIEEP SP P+                      PT+RL    F  N    ME NK  LQD   SSALVALTAE AS+P  KLK  + LRTEH VY LPD H LL   ++R+PDDP  YLLAIW+PGE+ +S+      C    +  LC+ E C+SCN + +  + IVRGTILIPCR A +G    NG   FQVN
Sbjct:  956 ECVRLLTLHHLAFPVDTNVGRIAVRLGWVPLQPLPESLQLHLLEMYPMLESIQKYLWPRLCKLDQKTLYELHYQMITFGKVFCTKSKPNCNACPMKGECRHFASAFASARLALP--------STEKGMGTPDKNPLPLHLPEPFQREQGSEVVQHSEPAKKVTCCEPIIEEPASPEPE--TAEVSIADIEEAFFEDPEEIPTIRLNMDAFTSNLKKIMEHNK-ELQDGNMSSALVALTAETASLPMPKLKNISQLRTEHRVYELPDEHPLLAQLEKREPDDPCSYLLAIWTPGETADSIQPSVSTCIFQANGMLCDEETCFSCNSIKETRSQIVRGTILIPCRTAMRGSFPLNGT-YFQVN 1304          
BLAST of DY258033 vs. ExPASy Swiss-Prot
Match: DML3_ARATH (DEMETER-like protein 3 OS=Arabidopsis thaliana GN=DML3 PE=2 SV=2)

HSP 1 Score: 293.123 bits (749), Expect = 2.251e-78
Identity = 168/369 (45.53%), Postives = 213/369 (57.72%), Query Frame = 2
Query:    2 ECVRLLSLQHIAFPVDVNVGRIAVRLGWVPLQPLPGDLHIHLLKEYPVVDKIQMYLWPRLCYLDQKTLYELHYQMITFGKIFCKKRSPNCGACPLRGECKHFASAVASARFALPGPS*KGIVTSEFGNGIGQSPPLVVNPIPVIRIEADPVSESGYQINNC-EPIIEEPRSPGPQCXXXXXXXXXXXXXXXXXXXXXPTLRLQEREFKENFPNFMEMNKVMLQD----SSALVALTAEAASV---PTRKLKRCAHLRTEHHVYVLPDAHELLRGFDRRDPDDPSPYLLAIWSPGESQNSVGSPQYRCNSKDSKLCNSEICYSCNIVCKRNAGIVRGTILIPCRIANKGKISFNGNILFQVNGSYWQNPE 1084
            ECVRLL L+H AFPVD NVGRIAVRLG VPL+PLP  + +H L EYP +D IQ YLWPRLC L Q+TLYELHYQMITFGK+FC K  PNC ACP++ ECK+FASA  S++  L  P  K    + F N    S  + V+    I +  + VS        C +P++E P SP  +                      P +       K++  + + ++  M       S ALV  T E A +   P RK+K    LRTEH VYVLPD HELL  F+RR  DDPSPYLLAIW PGE+ +S   P+ +C+S  SKLC  + C  C  + ++N+ I RGTILIPCR A +G         F +NG+Y+Q  E
Sbjct:  596 ECVRLLGLKHHAFPVDTNVGRIAVRLGLVPLEPLPNGVQMHQLFEYPSMDSIQKYLWPRLCKLPQETLYELHYQMITFGKVFCTKTIPNCNACPMKSECKYFASAYVSSKVLLESPEEKMHEPNTFMN--AHSQDVAVDMTSNINLVEECVSSGCSDQAICYKPLVEFPSSPRAEIPESTDIEDVPFMNLYQSYASVPKIDFDLDALKKSVEDALVISGRMSSSDEEISKALVIPTPENACIPIKPPRKMKYYNRLRTEHVVYVLPDNHELLHDFERRKLDDPSPYLLAIWQPGETSSSFVPPKKKCSSDGSKLCKIKNCSYCWTIREQNSNIFRGTILIPCRTAMRG--------AFPLNGTYFQTNE 954          
BLAST of DY258033 vs. ExPASy Swiss-Prot
Match: DML2_ARATH (DEMETER-like protein 2 OS=Arabidopsis thaliana GN=DML2 PE=2 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 9.159e-72
Identity = 160/370 (43.24%), Postives = 205/370 (55.41%), Query Frame = 2
Query:    2 ECVRLLSLQHIAFPVDVNVGRIAVRLGWVPLQPLPGDLHIHLLKEYPVVDKIQMYLWPRLCYLDQKTLYELHYQMITFGKIFCKKRSPNCGACPLRGECKHFASAVASARFALPGPS*KGIVTSEFGNGIGQSPPLVVNPIPVIRIEADPVSESGYQINNCEPIIEEPRSPGPQC-------XXXXXXXXXXXXXXXXXXXXXPTLRLQEREFKENFPNFMEMNKVMLQDSSALVALTAEAASVPTRKLKRCAHLRTEHHVYVLPDAHELLRGFDRRDPDDPSPYLLAIWSPGESQNSVGSPQYRCN--SKDSKLCNSEICYSCNIVCKRNAGIVRGTILIPCRIANKGKISFNGNILFQVNGSYWQNPE 1084
            ECVRLLSL  IAFPVD NVGRIAVRLGWVPLQPLP +L +HLL+                       LYELHY MITFGK+FC K  PNC ACP++ EC+H++SA ASAR ALP P      +        +  P+VVN  P + +  +   E+  +  NCEPIIEEP SP P+                             PT+ L +   +    + + +NK     S  LV L+  AA++P RKLK    LRTEHHV+ LPD H +L GF+RR+ +D  PYLLAIW+PGE+ NS+  P+ RC     ++ LCN   C+ CN   +  +  VRGTILIPCR A +G         F +NG+Y+Q  E
Sbjct:  888 ECVRLLSLHQIAFPVDTNVGRIAVRLGWVPLQPLPDELQMHLLE-----------------------LYELHYHMITFGKVFCTKVKPNCNACPMKAECRHYSSARASARLALPEPEESDRTSVMIHERRSKRKPVVVNFRPSLFLYQEKEQEA-QRSQNCEPIIEEPASPEPEYIEHDIEDYPRDKNNVGTSEDPWENKDVIPTIILNK---EAGTSHDLVVNK-EAGTSHDLVVLSTYAAAIPRRKLKIKEKLRTEHHVFELPDHHSILEGFERREAEDIVPYLLAIWTPGETVNSIQPPKQRCALFESNNTLCNENKCFQCNKTREEESQTVRGTILIPCRTAMRGG--------FPLNGTYFQTNE 1221          
The following BLAST results are available for this feature:
BLAST of DY258033 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
DME_ARATH4.362e-9851.54Transcriptional activator DEMETER OS=Arabidopsis t... [more]
ROS1_ARATH1.403e-9653.74Protein ROS1 OS=Arabidopsis thaliana GN=ROS1 PE=1 ... [more]
DML3_ARATH2.251e-7845.53DEMETER-like protein 3 OS=Arabidopsis thaliana GN=... [more]
DML2_ARATH9.159e-7243.24DEMETER-like protein 2 OS=Arabidopsis thaliana GN=... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAB2CH05ZM1 AbsCOv1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY258033 ID=DY258033; Name=DY258033; organism=Citrus clementina; type=EST; length=1245bp
GGAGTGTGTACGGCTTTTGTCACTTCAACACATTGCCTTTCCTGTTGATG
TGAATGTTGGGCGAATAGCTGTGCGTCTAGGCTGGGTTCCCCTCCAACCC
CTGCCTGGAGATCTTCACATACATCTTTTAAAAGAGTACCCAGTGGTGGA
TAAAATTCAAATGTATCTTTGGCCACGACTATGCTACCTTGACCAAAAAA
CATTATATGAACTACATTACCAAATGATTACCTTCGGAAAGATCTTCTGC
AAGAAGAGGAGTCCAAATTGCGGTGCTTGTCCATTGAGGGGGGAGTGCAA
ACACTTTGCCAGTGCAGTTGCGAGTGCAAGGTTTGCCTTACCAGGGCCAT
CATAAAAAGGGATAGTGACGTCAGAGTTTGGTAATGGAATTGGACAAAGC
CCTCCTTTGGTTGTCAATCCAATACCAGTGATTCGCATTGAGGCTGATCC
GGTTTCAGAATCTGGATATCAAATCAACAACTGTGAGCCTATCATTGAGG
AGCCACGGTCACCAGGGCCTCAATGTTCAGAATCTCCAGAATCTGAGATT
GATGATGATGATTTCAGCATTGGTGACATTGAAGAGATTCCTACTCTCAG
ACTGCAAGAAAGGGAGTTCAAGGAAAATTTCCCAAATTTCATGGAGATGA
ACAAGGTCATGCTTCAAGACTCCAGTGCTTTAGTTGCTTTGACTGCAGAA
GCTGCATCCGTGCCCACAAGGAAACTGAAGAGATGTGCTCATTTACGCAC
AGAGCACCATGTCTATGTACTTCCAGATGCGCATGAACTACTTCGAGGGT
TTGATAGGCGAGATCCTGATGATCCGTCTCCCTACCTTCTTGCGATATGG
TCACCAGGTGAATCTCAAAATTCAGTTGGCTCACCACAGTACAGATGTAA
CTCCAAAGATTCCAAACTTTGCAATTCGGAGATATGCTATTCTTGCAATA
TTGTTTGTAAAAGAAATGCTGGTATAGTTCGCGGAACAATTTTGATACCT
TGTCGCATCGCAAATAAAGGCAAAATTTCCTTTAATGGAAACATACTTTT
TCAGGTTAATGGAAGTTATTGGCAAAACCCTGAAAACGAAGCCCTCCCCC
CCCCTTTAAAGGTTTCCATAGGCCCACCCAATTTGCTTATTTCTACCCAA
AAAAAAAAAACCCCTCTCGCCCTTTTTGGAAAATTTTACACCCAAAAAAA
AAATTTTTTTTTTAATATGGCTTTTTTTATAAAAACATGTGGCGG
back to top