DY258036

Overview
NameDY258036
Unique NameDY258036
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1172
Libraries
Library NameType
AbsCOv1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DY258036 vs. ExPASy Swiss-Prot
Match: PSUG2_PHOLL (Pseudouridine-5'-phosphate glycosidase 2 OS=Photorhabdus luminescens subsp. laumondii GN=psuG2 PE=3 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 2.669e-72
Identity = 136/258 (52.71%), Postives = 177/258 (68.60%), Query Frame = 1
Query:  100 SLAKNLVKISPEVSEALSHGHAVVALESTIISHGMPYPQNFETAKEVEAIVRNNGAVPATIAILEGLPCVGLSTEELERLAKLGSKAQKTARRDIAHVVATRGNGATTVSATMFFASMVGIPVFVTGGIGGVHRRGEHTMDISSDLKELGRTPVAVVSAGIKSILDIPRTLEYLETHGVCVAAYKTNEFPAFFTETSGSKVPCRVDSPEDCARLIDVNMKLKLGSGIVIGVPIPREHAAFGRVIESAIQSALREAREK 873
            +++   + ISPEV+EAL +   VVALESTII+HGMPYPQN +TA +VE  +R NGAVPATIA++ G+   GLS EE+  LA+ G +  K +RRD+  V+A   NGATTV++TM  A+M GI +F TGGIGGVHR  E T DIS+DL+EL +T VAVV AG KSILD+  T EYLETHGV +  Y+T+  PAFF  TS   V  R+DSPE  A+ + V     L  G+V+  PIP  +A     I +AI+ A+RE+ E+
Sbjct:    5 AISNKYLDISPEVTEALENNRPVVALESTIIAHGMPYPQNVKTALQVEQKIRENGAVPATIAVINGMMKAGLSHEEIAFLARKGDEITKVSRRDLPFVIAAGKNGATTVASTMIIAAMAGIRIFATGGIGGVHRGAEQTFDISADLQELAKTSVAVVCAGAKSILDLGLTTEYLETHGVPLIGYQTHALPAFFCRTSPFSVNIRLDSPEQIAQAMAVKWDTGLQGGLVVANPIPEPYAMPEAEISAAIEQAVRESIEQ 262          

HSP 2 Score: 35.4242 bits (80), Expect = 2.669e-72
Identity = 19/34 (55.88%), Postives = 22/34 (64.71%), Query Frame = 3
Query:  876 ITGNAETPFLLARVNDLTGGFSLPQTFAL*KINA 977
            + G A TPFLLARV++LTGG SL     L   NA
Sbjct:  264 VNGKACTPFLLARVSELTGGNSLSSNIQLVLNNA 297          
BLAST of DY258036 vs. ExPASy Swiss-Prot
Match: PSUG_HAHCH (Pseudouridine-5'-phosphate glycosidase OS=Hahella chejuensis (strain KCTC 2396) GN=psuG PE=3 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 2.914e-71
Identity = 137/250 (54.80%), Postives = 174/250 (69.60%), Query Frame = 1
Query:  124 ISPEVSEALSHGHAVVALESTIISHGMPYPQNFETAKEVEAIVRNNGAVPATIAILEGLPCVGLSTEELERLAKLGSKAQKTARRDIAHVVATRGNGATTVSATMFFASMVGIPVFVTGGIGGVHRRGEHTMDISSDLKELGRTPVAVVSAGIKSILDIPRTLEYLETHGVCVAAYKTNEFPAFFTETSGSKVPCRVDSPEDCARLIDVNMKLKLGSGIVIGVPIPREHAAFGRVIESAIQSALREAREK 873
            ISPEV  AL+ G  VVALESTIISHGMP+PQN ETA +VE IVR+NGAVPATIAI++G   VGLS EE+E L K G    K +RRDI  ++A  G+GATTV++TM  A+M G+ VF TGGIGGVHR  + T DIS+DL+EL  T VAV+ AG KSILD+  T EYLETHGV +  Y+T+  PAF+T  S   V  ++D+PE  A+ +    ++ L  G+VI  PIP  +A     I++AI +AL E  +K
Sbjct:    7 ISPEVQTALAAGEPVVALESTIISHGMPWPQNAETALQVEQIVRDNGAVPATIAIIKGRLKVGLSKEEIEYLGKAGLNVTKASRRDIPFIIARGGDGATTVASTMILAAMAGVKVFATGGIGGVHRGAQETFDISADLQELAHTNVAVICAGAKSILDLGLTREYLETHGVPLVGYQTSTLPAFYTRDSDFDVDYQLDTPEQIAQALQAKWEMGLQGGVVIANPIPEAYAMDRGKIDAAISAALAEMDDK 256          

HSP 2 Score: 31.187 bits (69), Expect = 2.914e-71
Identity = 14/29 (48.28%), Postives = 19/29 (65.52%), Query Frame = 3
Query:  876 ITGNAETPFLLARVNDLTGGFSLPQTFAL 962
            ++G   TPFLLA+V ++TGG SL     L
Sbjct:  258 VSGKDSTPFLLAKVAEITGGDSLKANIQL 286          
BLAST of DY258036 vs. ExPASy Swiss-Prot
Match: PSUG_SORC5 (Pseudouridine-5'-phosphate glycosidase OS=Sorangium cellulosum (strain So ce56) GN=psuG PE=3 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 5.496e-71
Identity = 142/250 (56.80%), Postives = 179/250 (71.60%), Query Frame = 1
Query:  109 KNLVKISPEVSEALSHGHAVVALESTIISHGMPYPQNFETAKEVEAIVRNNGAVPATIAILEGLPCVGLSTEELERLAKLGSKAQKTARRDIAHVVATRGNGATTVSATMFFASMVGIPVFVTGGIGGVHRRGEHTMDISSDLKELGRTPVAVVSAGIKSILDIPRTLEYLETHGVCVAAYKTNEFPAFFTETSGSKVPCRVDSPEDCARLIDVNMKLKLGSGIVIGVPIPREHAAFGRVIESAIQSALR 858
            K+ + IS EV +AL+ G  VVALESTII+HGMPYPQN E  + VEA+VR NGAVPATIAI++G   VG+  E+LERLA+ G KA K +RRD+A ++   G   TTV+ TM  A+  GI VF TGGIGGVHR  E T DIS+DL+EL +T VAVV AG KSILDIP+TLE LETHGV V  YKT +FPAF+   SG KV  R++S E+ AR+I +  +L +G G+++  PIP  HA   R IE+ I+ A+R
Sbjct:    4 KDHLSISSEVRKALAGGRPVVALESTIITHGMPYPQNLEMVRRVEAVVRRNGAVPATIAIMDGKLRVGVKGEDLERLARGGGKAAKASRRDVAALLVLGGMAGTTVATTMMAAAWAGIQVFATGGIGGVHRGAETTFDISADLEELSQTQVAVVCAGAKSILDIPKTLETLETHGVPVLGYKTEDFPAFWARQSGQKVDHRIESAEEAARVIALQFELGMG-GVLVANPIPESHAMDARAIEARIEEAIR 252          
BLAST of DY258036 vs. ExPASy Swiss-Prot
Match: PSUG_CLOBL (Pseudouridine-5'-phosphate glycosidase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=psuG PE=3 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 3.179e-70
Identity = 139/257 (54.09%), Postives = 175/257 (68.09%), Query Frame = 1
Query:  103 LAKNLVKISPEVSEALSHGHAVVALESTIISHGMPYPQNFETAKEVEAIVRNNGAVPATIAILEGLPCVGLSTEELERLAKLGSKAQKTARRDIAHVVATRGNGATTVSATMFFASMVGIPVFVTGGIGGVHRRGEHTMDISSDLKELGRTPVAVVSAGIKSILDIPRTLEYLETHGVCVAAYKTNEFPAFFTETSGSKVPCRVDSPEDCARLIDVNMKLKLGSGIVIGVPIPREHAAFGRVIESAIQSALREAREK 873
            + +  ++IS EVSEAL     VVALESTIISHGMPYP+N ETA  VE I+R+ GA+PATIAIL G   VGL+ +E+E L K G +  KT+RRDI  ++A + +GATTV++TM  A++ GI VF TGGIGGVHR  + + DIS+DL+EL  T VAVV AG KSILDI  TLEYLET GV V  + T E PAF+T  SG KV  RVD+ ++ A  +     L L  G+V+G PIP E+      I  AI  A++EA EK
Sbjct:    1 MLEKYLEISKEVSEALKENKPVVALESTIISHGMPYPKNAETALNVEKIIRDKGAIPATIAILNGKLKVGLTKDEIEYLGKKGKEVVKTSRRDIPFILAKKLDGATTVASTMIVANLAGIKVFGTGGIGGVHRGAQESFDISADLQELANTNVAVVCAGAKSILDIGLTLEYLETQGVPVVGFGTEELPAFYTRKSGFKVDYRVDTAKELAEALKAKWDLGLKGGMVVGNPIPEEYQMDYDTITKAINDAVKEAEEK 257          

HSP 2 Score: 30.4166 bits (67), Expect = 3.179e-70
Identity = 15/29 (51.72%), Postives = 17/29 (58.62%), Query Frame = 3
Query:  876 ITGNAETPFLLARVNDLTGGFSLPQTFAL 962
            I G   TPFLLA+V D+T G SL     L
Sbjct:  259 IKGKESTPFLLAKVKDITKGKSLEANIQL 287          
BLAST of DY258036 vs. ExPASy Swiss-Prot
Match: PSUG_RHOCS (Pseudouridine-5'-phosphate glycosidase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=psuG PE=3 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 4.145e-70
Identity = 139/251 (55.38%), Postives = 174/251 (69.32%), Query Frame = 1
Query:  112 NLVKISPEVSEALSHGHAVVALESTIISHGMPYPQNFETAKEVEAIVRNNGAVPATIAILEGLPCVGLSTEELERLAKLGSKAQKTARRDIAHVVATRGNGATTVSATMFFASMVGIPVFVTGGIGGVHRRGEHTMDISSDLKELGRTPVAVVSAGIKSILDIPRTLEYLETHGVCVAAYKTNEFPAFFTETSGSKVPCRVDSPEDCARLIDVNMKLKLGSGIVIGVPIPREHAAFGRVIESAIQSALREA 864
            + + I PEV+ AL  G  VVALEST+ISHG+P P N ETA+ +EA VR NGAVPATIA+L+G   VGL  E+++RLA  G+   K +RRD+  V+A   +GATTV+ATM  A + GI VF TGGIGGVHR  E T DIS+DL+EL  T VAVV AG K+ILD+PRTLEYLET GV V  + T+ FPAF+   SG  V  R D+PED AR+++   +L L  GIV+ VPIP E A      E+A+Q A+ EA
Sbjct:    3 DFLSIHPEVAAALKAGRPVVALESTLISHGLPAPANLETAQAIEAAVRANGAVPATIAVLDGRIRVGLDAEDMQRLAAPGTA--KVSRRDLPLVLAKGADGATTVAATMIAADLAGIAVFATGGIGGVHRGVETTGDISADLEELATTSVAVVCAGAKAILDLPRTLEYLETRGVPVVGFGTDAFPAFYHRDSGLPVDGRCDTPEDAARVLNAKWRLGLAGGIVVAVPIPDEAALDAAQAEAAVQQAVAEA 251          

HSP 2 Score: 31.187 bits (69), Expect = 4.145e-70
Identity = 18/34 (52.94%), Postives = 20/34 (58.82%), Query Frame = 3
Query:  876 ITGNAETPFLLARVNDLTGGFSLPQTFAL*KINA 977
            + G A TPFLL R+  LTGG SL    AL   NA
Sbjct:  256 VRGKALTPFLLHRLETLTGGASLTANRALLLNNA 289          
BLAST of DY258036 vs. ExPASy Swiss-Prot
Match: PSUG_ECOLI (Pseudouridine-5'-phosphate glycosidase OS=Escherichia coli (strain K12) GN=psuG PE=1 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 7.050e-70
Identity = 136/254 (53.54%), Postives = 169/254 (66.54%), Query Frame = 1
Query:  103 LAKNLVKISPEVSEALSHGHAVVALESTIISHGMPYPQNFETAKEVEAIVRNNGAVPATIAILEGLPCVGLSTEELERLAKLGSKAQKTARRDIAHVVATRGNGATTVSATMFFASMVGIPVFVTGGIGGVHRRGEHTMDISSDLKELGRTPVAVVSAGIKSILDIPRTLEYLETHGVCVAAYKTNEFPAFFTETSGSKVPCRVDSPEDCARLIDVNMKLKLGSGIVIGVPIPREHAAFGRVIESAIQSALREA 864
            ++  L++ISPEV +AL +   VVALESTIISHGMP+PQN +TA EVE  +R  GAVPATIAI+ G+  VGLS EE+E L + G    K +RRD+  VVA   NGATTV++TM  A++ GI VF TGGIGGVHR  EHT DIS+DL+EL  T V VV AG KSILD+  T EYLET GV +  Y+T   PAFF  TS   V  R+DS  + AR + V  +  L  G+V+  PIP + A     I +AI  A+ EA
Sbjct:    6 ISPELLQISPEVQDALKNKKPVVALESTIISHGMPFPQNAQTAIEVEETIRKQGAVPATIAIIGGVMKVGLSKEEIELLGREGHNVTKVSRRDLPFVVAAGKNGATTVASTMIIAALAGIKVFATGGIGGVHRGAEHTFDISADLQELANTNVTVVCAGAKSILDLGLTTEYLETFGVPLIGYQTKALPAFFCRTSPFDVSIRLDSASEIARAMVVKWQSGLNGGLVVANPIPEQFAMPEHTINAAIDQAVAEA 259          

HSP 2 Score: 35.039 bits (79), Expect = 7.050e-70
Identity = 19/40 (47.50%), Postives = 23/40 (57.50%), Query Frame = 3
Query:  870 EDITGNAETPFLLARVNDLTGGFSLPQTFAL*KINALYRS 989
            + + G   TPFLLARV +LTGG SL     L   NA+  S
Sbjct:  262 QGVIGKESTPFLLARVAELTGGDSLKSNIQLVFNNAILAS 301          
BLAST of DY258036 vs. ExPASy Swiss-Prot
Match: PSUG_SOLUE (Pseudouridine-5'-phosphate glycosidase OS=Solibacter usitatus (strain Ellin6076) GN=psuG PE=3 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 7.053e-70
Identity = 137/250 (54.80%), Postives = 174/250 (69.60%), Query Frame = 1
Query:  118 VKISPEVSEALSHGHAVVALESTIISHGMPYPQNFETAKEVEAIVRNNGAVPATIAILEGLPCVGLSTEELERLAKLGSK-AQKTARRDIAHVVATRGNGATTVSATMFFASMVGIPVFVTGGIGGVHRRGEHTMDISSDLKELGRTPVAVVSAGIKSILDIPRTLEYLETHGVCVAAYKTNEFPAFFTETSGSKVPCRVDSPEDCARLIDVNMKLKLGSGIVIGVPIPREHAAFGRVIESAIQSALREA 864
            +KI PEV  AL     VVALESTII+HGMPYP+N  TA+ +E+ VR  GAVPATIA++ G+ CVGLS +ELE LA  G+K   K +R D+ + +AT+  GATTV+ATM  A++ GI +F TGGIGGVHR  E T DIS+DL+E  RT VAVV AG K+ILD+P+TLEYLET GV V AY T+EFPAF++  SG K P R+D+P + AR ++V   L L  G VI  P+P E       + + I SA+ EA
Sbjct:    3 LKIDPEVRRALQGKRPVVALESTIITHGMPYPENLATARSLESQVRAGGAVPATIAVIGGVICVGLSDKELEWLA--GAKNVLKLSRNDLPYAIATQKIGATTVAATMIAANLAGIRIFATGGIGGVHRGAETTFDISADLEEFARTSVAVVCAGAKAILDLPKTLEYLETRGVPVIAYGTDEFPAFWSRQSGLKAPLRLDTPAEIARFLEVKWSLNLTGGAVICNPVPAEDEIPFHEMRTFIDSAVDEA 250          

HSP 2 Score: 34.6538 bits (78), Expect = 7.053e-70
Identity = 18/34 (52.94%), Postives = 23/34 (67.65%), Query Frame = 3
Query:  876 ITGNAETPFLLARVNDLTGGFSLPQTFAL*KINA 977
            I G A TP++LAR+ +LTGG SL    AL + NA
Sbjct:  255 IKGKAVTPYILARIVELTGGRSLRTNMALAQNNA 288          
BLAST of DY258036 vs. ExPASy Swiss-Prot
Match: PSUG_THETN (Pseudouridine-5'-phosphate glycosidase OS=Thermoanaerobacter tengcongensis GN=psuG PE=3 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 9.195e-70
Identity = 140/249 (56.22%), Postives = 170/249 (68.27%), Query Frame = 1
Query:  118 VKISPEVSEALSHGHAVVALESTIISHGMPYPQNFETAKEVEAIVRNNGAVPATIAILEGLPCVGLSTEELERLAKLGSKAQKTARRDIAHVVATRGNGATTVSATMFFASMVGIPVFVTGGIGGVHRRGEHTMDISSDLKELGRTPVAVVSAGIKSILDIPRTLEYLETHGVCVAAYKTNEFPAFFTETSGSKVPCRVDSPEDCARLIDVNMKLKLGSGIVIGVPIPREHAAFGRVIESAIQSALREA 864
            + +S EV  AL     VVALESTIISHGMPYPQN ETA+ +E IVR NGAVPATIAI+ G   +GL+ EELE +     +  K ++RD+  V+A   N ATTVSATM  A++ GI VFVTGGIGGVHR  E T DIS+DL+EL  T VAVV AG K+ILD+PRTLEYLET GV V  ++T EFPAF+T  SG KV  RV+   + A++I     L L  GI+I  PIP E+A     IE AI+ A+ EA
Sbjct:    5 IDLSEEVKSALEERRPVVALESTIISHGMPYPQNIETARALEEIVRENGAVPATIAIIGGKIKIGLNEEELEFMGT-SKEILKASKRDLPVVLAKGLNAATTVSATMICANLAGIKVFVTGGIGGVHRGAEETFDISADLQELANTNVAVVCAGAKAILDLPRTLEYLETFGVPVIGFRTEEFPAFYTRESGLKVDYRVEDEVEAAKVIKTKWDLGLKGGILIANPIPEEYALDRAYIEKAIEEAIFEA 252          

HSP 2 Score: 32.7278 bits (73), Expect = 9.195e-70
Identity = 18/34 (52.94%), Postives = 20/34 (58.82%), Query Frame = 3
Query:  876 ITGNAETPFLLARVNDLTGGFSLPQTFAL*KINA 977
            I G A TPFLL ++ DLT G SL     L K NA
Sbjct:  257 IRGKALTPFLLEKIKDLTEGKSLKANIELVKNNA 290          
BLAST of DY258036 vs. ExPASy Swiss-Prot
Match: PSUG_GEOKA (Pseudouridine-5'-phosphate glycosidase OS=Geobacillus kaustophilus GN=psuG PE=3 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 9.197e-70
Identity = 132/249 (53.01%), Postives = 173/249 (69.48%), Query Frame = 1
Query:  127 SPEVSEALSHGHAVVALESTIISHGMPYPQNFETAKEVEAIVRNNGAVPATIAILEGLPCVGLSTEELERLAKLGSKAQKTARRDIAHVVATRGNGATTVSATMFFASMVGIPVFVTGGIGGVHRRGEHTMDISSDLKELGRTPVAVVSAGIKSILDIPRTLEYLETHGVCVAAYKTNEFPAFFTETSGSKVPCRVDSPEDCARLIDVNMKLKLGSGIVIGVPIPREHAAFGRVIESAIQSALREAREK 873
            S EV++A +    +VALESTIISHGMPYP+N +TAK+VE I+R+ GAVPATIAI      +GL+  ELE+L       +K +RRD+ +VVA + +GATTV+ TM  A M GI VF TGGIGGVHR  E TMDIS+DL+EL RT VAVV AG KSILD+  TLEYLETHGV V  Y+T+  PAF++ TS  +V  R+DS ++ A+ ++   KL L  G+VI  P+P+E       I + I+ AL+EA ++
Sbjct:    8 SEEVAQAKAEKKPIVALESTIISHGMPYPENVQTAKDVERIIRDRGAVPATIAIFNEKIKIGLTEGELEQLGT-SHDVEKVSRRDLPYVVAMKKHGATTVAGTMICAEMAGIRVFATGGIGGVHRGAEQTMDISADLQELARTNVAVVCAGAKSILDLGLTLEYLETHGVPVIGYQTDVLPAFYSRTSPFRVDYRLDSAKEIAQFLETKWKLGLNGGVVIANPVPKEEELEESYITAIIEQALKEAEKQ 255          

HSP 2 Score: 38.1206 bits (87), Expect = 9.197e-70
Identity = 21/36 (58.33%), Postives = 23/36 (63.89%), Query Frame = 3
Query:  870 EDITGNAETPFLLARVNDLTGGFSLPQTFAL*KINA 977
            + ITG + TPFLL RV  LTGG SL    AL K NA
Sbjct:  255 QHITGKSVTPFLLDRVKTLTGGKSLQANIALVKNNA 290          
BLAST of DY258036 vs. ExPASy Swiss-Prot
Match: PSUG_METNO (Pseudouridine-5'-phosphate glycosidase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=psuG PE=3 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 1.705e-68
Identity = 131/251 (52.19%), Postives = 167/251 (66.53%), Query Frame = 1
Query:  115 LVKISPEVSEALSHGHAVVALESTIISHGMPYPQNFETAKEVEAIVRNNGAVPATIAILEGLPCVGLSTEELERLAKLGSKAQKTARRDIAHVVATRGNGATTVSATMFFASMVGIPVFVTGGIGGVHRRGEHTMDISSDLKELGRTPVAVVSAGIKSILDIPRTLEYLETHGVCVAAYKTNEFPAFFTETSGSKVPCRVDSPEDCARLIDVNMKLKLGSGIVIGVPIPREHAAFGRVIESAIQSALREAR 867
            L+  +PEV  AL  G  VVALESTI++HGMP+PQN ETA+ V A+VR NGAVPA +A++ G   +GL  E L+ L     +  K +R D+ H VA   +G+TTV+ATM  A   GI VF TGGIGGVHR  E T+DIS+DL EL RTPVAVV AG K+ILD+PRTLEYLET GV V  Y+T+ FPAF++  SG   P R+D+PE  A L+     L LG GI++  P+P       R I + I +A+ +AR
Sbjct:    5 LLDFAPEVRSALDAGAPVVALESTIVTHGMPHPQNVETARAVAAVVRANGAVPAIVAVVAGRIRIGLPEEILDWLGT-AKEVLKLSRADLPHAVAAGLHGSTTVAATMICAHRAGIRVFATGGIGGVHRGVEETLDISADLDELARTPVAVVCAGAKAILDLPRTLEYLETRGVPVVGYRTDRFPAFWSRDSGLPAPLRLDTPEAIAALMRTKEALDLGGGILVANPVPEADEIPAREIAALIATAVAQAR 254          

HSP 2 Score: 38.5058 bits (88), Expect = 1.705e-68
Identity = 21/34 (61.76%), Postives = 23/34 (67.65%), Query Frame = 3
Query:  876 ITGNAETPFLLARVNDLTGGFSLPQTFAL*KINA 977
            I G A TPFLL+R+ DLTGG SL    AL K NA
Sbjct:  258 IAGKAVTPFLLSRLLDLTGGRSLSTNIALVKNNA 291          
The following BLAST results are available for this feature:
BLAST of DY258036 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 57
Match NameE-valueIdentityDescription
PSUG2_PHOLL2.669e-7252.71Pseudouridine-5'-phosphate glycosidase 2 OS=Photor... [more]
PSUG_HAHCH2.914e-7154.80Pseudouridine-5'-phosphate glycosidase OS=Hahella ... [more]
PSUG_SORC55.496e-7156.80Pseudouridine-5'-phosphate glycosidase OS=Sorangiu... [more]
PSUG_CLOBL3.179e-7054.09Pseudouridine-5'-phosphate glycosidase OS=Clostrid... [more]
PSUG_RHOCS4.145e-7055.38Pseudouridine-5'-phosphate glycosidase OS=Rhodospi... [more]
PSUG_ECOLI7.050e-7053.54Pseudouridine-5'-phosphate glycosidase OS=Escheric... [more]
PSUG_SOLUE7.053e-7054.80Pseudouridine-5'-phosphate glycosidase OS=Solibact... [more]
PSUG_THETN9.195e-7056.22Pseudouridine-5'-phosphate glycosidase OS=Thermoan... [more]
PSUG_GEOKA9.197e-7053.01Pseudouridine-5'-phosphate glycosidase OS=Geobacil... [more]
PSUG_METNO1.705e-6852.19Pseudouridine-5'-phosphate glycosidase OS=Methylob... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAB2CH12ZM1 AbsCOv1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY258036 ID=DY258036; Name=DY258036; organism=Citrus clementina; type=EST; length=1172bp
GGCTCACTTTCAACAAATTTGGCGGCGTCTTCTTCTGCTTCTTCATCATC
GGCTCTCTCAAGATTGTCCAATATTCAAAATCACTTAAACCCCATTGATT
CACTTGCTAAAAATTTAGTGAAGATATCTCCAGAGGTCAGTGAAGCTTTG
TCGCATGGCCACGCTGTTGTTGCTCTTGAATCCACAATTATTTCCCATGG
GATGCCGTATCCTCAAAATTTTGAGACAGCCAAGGAGGTTGAGGCCATTG
TGAGAAATAATGGAGCAGTTCCTGCAACGATTGCTATTCTAGAGGGCCTT
CCATGCGTAGGTTTGAGTACAGAAGAACTGGAAAGGCTGGCTAAGTTAGG
AAGTAAAGCTCAAAAGACAGCTCGGAGGGACATTGCACATGTTGTGGCTA
CCAGAGGGAACGGAGCAACTACTGTTTCCGCGACCATGTTTTTTGCTTCT
ATGGTTGGCATTCCTGTGTTTGTAACTGGGGGAATTGGAGGTGTACATAG
GCGCGGCGAGCACACTATGGATATTTCATCAGATCTTAAAGAGCTCGGAA
GGACTCCAGTGGCCGTCGTCTCTGCTGGCATAAAGTCAATACTAGATATC
CCCAGGACCCTCGAGTATTTGGAAACTCATGGAGTTTGTGTTGCTGCTTA
TAAGACGAATGAGTTTCCGGCTTTTTTCACTGAAACCAGTGGCTCCAAGG
TGCCTTGTCGCGTTGATAGCCCAGAAGATTGTGCTCGGTTAATAGATGTA
AACATGAAACTTAAGCTTGGATCTGGAATTGTGATTGGTGTCCCAATCCC
AAGAGAACATGCAGCTTTTGGGAGAGTAATTGAGTCTGCAATACAAAGTG
CCCTCAGAGAAGCTAGGGAGAAGATATAACAGGTAATGCAGAGACTCCTT
TCTTGCTTGCAAGAGTGAATGACCTAACTGGAGGCTTTTCACTGCCTCAA
ACATTTGCCTTGTGAAAAATAAATGCTCTTTATCGGAGCTAAGAATTTTT
GTACCACTTGCCCAGCTCAAAAAACAAAAAAAGTAATTAAGGGGACTTTG
TTTTTCCTGGCAAATTTTTCAAAATATTTGGACCTTTTTTCGGGGACGGG
CAAAAGGGGAAAGGAAAAAAAATGGGTTGGAAAAAAAACTTTTAACCTGG
GAAAAGCCGGGCACCATGAAAA
back to top