DY258458

Overview
NameDY258458
Unique NameDY258458
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length916
Libraries
Library NameType
AbsDev1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DY258458 vs. ExPASy Swiss-Prot
Match: TRPD_ARATH (Anthranilate phosphoribosyltransferase, chloroplastic OS=Arabidopsis thaliana GN=PAT1 PE=2 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 6.351e-82
Identity = 153/212 (72.17%), Postives = 173/212 (81.60%), Query Frame = 3
Query:   45 DVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRPVRKKLKVKTVFNILGPMLNPACVPFAVVGVYNENLVLKMANALQRFGLKRALVVHSEGLDEMSPLGPGLILDVTQEKIERFSFDPLDYGIPRCTLESLQGGGPAYNAEVLRRVLSGERGXXXXXXXXXXXXXXXVSCKVNTLAEGVALAREIQLSGKALNTLDLWIEVS 680
            DVLEALGVV+DL PEG++RCV+E GIGFMMS  YHPAMK V PVRKKLK+KTVFNILGPMLNPA V +AVVGVY+++LV+KMA ALQRFG+KRALVVHS GLDEMSPLG GL+ DVT EKIE FSFDPLD+GIPRCTLE L+GGGP YNA+VLRRVLSGE G               VS +V TLAEGV +ARE+Q SGKA+ TLD WI +S
Sbjct:  226 DVLEALGVVLDLGPEGIKRCVEEGGIGFMMSPMYHPAMKIVGPVRKKLKIKTVFNILGPMLNPARVSYAVVGVYHKDLVVKMAKALQRFGMKRALVVHSCGLDEMSPLGGGLVYDVTPEKIEEFSFDPLDFGIPRCTLEDLRGGGPDYNADVLRRVLSGESGAIADSLILNAAAALLVSNRVQTLAEGVTVAREVQSSGKAIKTLDSWINIS 437          
BLAST of DY258458 vs. ExPASy Swiss-Prot
Match: TRPD_CHLSY (Anthranilate phosphoribosyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=trpD PE=3 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 9.278e-41
Identity = 99/217 (45.62%), Postives = 129/217 (59.45%), Query Frame = 3
Query:   45 DVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRPVRKKLKVKTVFNILGPMLNPACVPFAVVGVYNENLVLKMANALQRFGLKRALVVHSE-GLDEMSPLGPGLILDVTQEKIER-FSFDPLDYGIPRCTLESLQGGGPAYNAEVLRRVLSG-ERGXXXXXXXXXXXXXXXVSCKVNTLAEGVALAREIQLSGKALNTLDLWIEVSEG 686
            DVLE LGV I+LD EGV RC+ EAGIGFM + K+HPAM+F  PVR+++ ++TVFNILGP+ NPA   + V+GV +  L  K+A AL R     ALVVH + G+DE++  GP LI DV   +  R     P D G+PR   ++L+GG  AYN  ++R +LSG E G                      LA GVA+AR    SG+AL  L+  I VS G
Sbjct:  122 DVLEGLGVQIELDAEGVARCLREAGIGFMFAPKFHPAMRFAGPVRREIGIRTVFNILGPLTNPARARYQVLGVASAALAEKLAYALSRLDTVHALVVHGDGGVDELTLSGPNLIFDVRAGQAPRQMLVAPEDVGLPRAPQDALRGGDVAYNVAIVRAILSGEEHGPRRDVVLFNAAAAMVAGDLAPDLATGVAMARHSIDSGRALERLNQMIAVSRG 338          
BLAST of DY258458 vs. ExPASy Swiss-Prot
Match: TRPD_CHLAA (Anthranilate phosphoribosyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=trpD PE=3 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 9.278e-41
Identity = 99/217 (45.62%), Postives = 129/217 (59.45%), Query Frame = 3
Query:   45 DVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRPVRKKLKVKTVFNILGPMLNPACVPFAVVGVYNENLVLKMANALQRFGLKRALVVHSE-GLDEMSPLGPGLILDVTQEKIER-FSFDPLDYGIPRCTLESLQGGGPAYNAEVLRRVLSG-ERGXXXXXXXXXXXXXXXVSCKVNTLAEGVALAREIQLSGKALNTLDLWIEVSEG 686
            DVLE LGV I+LD EGV RC+ EAGIGFM + K+HPAM+F  PVR+++ ++TVFNILGP+ NPA   + V+GV +  L  K+A AL R     ALVVH + G+DE++  GP LI DV   +  R     P D G+PR   ++L+GG  AYN  ++R +LSG E G                      LA GVA+AR    SG+AL  L+  I VS G
Sbjct:  122 DVLEGLGVQIELDAEGVARCLREAGIGFMFAPKFHPAMRFAGPVRREIGIRTVFNILGPLTNPARARYQVLGVASAALAEKLAYALSRLDTVHALVVHGDGGVDELTLSGPNLIFDVRAGQAPRQMLVAPEDVGLPRAPQDALRGGDVAYNVAIVRAILSGEEHGPRRDVVLFNAAAAMVAGDLAPDLATGVAMARHSIDSGRALERLNQMIAVSRG 338          
BLAST of DY258458 vs. ExPASy Swiss-Prot
Match: TRPD_RUBXD (Anthranilate phosphoribosyltransferase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=trpD PE=3 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.583e-40
Identity = 95/214 (44.39%), Postives = 128/214 (59.81%), Query Frame = 3
Query:   45 DVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRPVRKKLKVKTVFNILGPMLNPACVPFAVVGVYNENLVLKMANALQRFGLKRALVVHS-EGLDEMSPLGPGLILDVTQEKIERFSFDPLDYGIPRCTLESLQGGGPAYNAEVLRRVLSG-ERGXXXXXXXXXXXXXXXVSCKVNTLAEGVALAREIQLSGKALNTLDLWIEVS 680
            DVLEALG  I+L PE V RC++EAGIGFM +  +HPAM+ V PVR +L  +TVFN+LGP+ NPA     +VGV++   V  MA AL+  G +RALVVH  +G+DE++  GP L+ +V    +E +   P D+G+ R   + L GG    NA +LR VLSG ERG               V+ K  ++ EGV LA     SG AL  L+ ++ VS
Sbjct:  121 DVLEALGAAIELSPEQVSRCIEEAGIGFMFARTHHPAMRHVAPVRAELPFRTVFNLLGPLTNPAGARRQLVGVFSAGYVRPMAEALEGLGAERALVVHGRDGMDEITVTGPTLVAEVGGGGVEEYEISPEDFGLSRHAPDGLLGGDAHLNARILRDVLSGEERGASRDVIVLNAGAAIYVAGKAPSIEEGVRLAEGSLESGAALAALERFVRVS 334          
BLAST of DY258458 vs. ExPASy Swiss-Prot
Match: TRPD_RHILO (Anthranilate phosphoribosyltransferase OS=Rhizobium loti GN=trpD PE=3 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 6.014e-40
Identity = 86/214 (40.19%), Postives = 125/214 (58.41%), Query Frame = 3
Query:   45 DVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRPVRKKLKVKTVFNILGPMLNPACVPFAVVGVYNENLVLKMANALQRFGLKRALVVHSEGLDEMSPLGPGLILDVTQEKIERFSFDPLDYGIPRCTLESLQGGGPAYNAEVLRRVLSGERGXXXXXXXXXXXXXXXVSCKVNTLAEGVALAREIQLSGKALNTLDLWIEVSEG 686
            DVL ALGV ID+ P+ + RC+ EAG+GFM +  +HPAMK V P R +L  +T+FN+LGP+ NPA V   +VGV+    +L +A  L+  G + A VVH +G DE++  G   + ++   +I  F+  P + G+ R T + L+GG  AYNA  LR +L G  G               ++ K  TL +G+ALA +   SG+AL  LD  +E+S G
Sbjct:  123 DVLIALGVKIDIPPDAIGRCIHEAGVGFMFAPAHHPAMKHVGPTRVELGTRTIFNLLGPLSNPAGVVRQMVGVFLPEWILPVAETLKALGTEHAWVVHGDGYDEITTTGETQVAELIGGEIRSFTLTPEEVGLKRHTKDELRGGDAAYNANALRDMLDGAAGAYRDTVLMNAGAGLVIAGKATTLGDGIALAAQAIDSGRALQVLDRLVEISNG 336          
BLAST of DY258458 vs. ExPASy Swiss-Prot
Match: TRPD_CHLAD (Anthranilate phosphoribosyltransferase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=trpD PE=3 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 1.026e-39
Identity = 97/217 (44.70%), Postives = 128/217 (58.99%), Query Frame = 3
Query:   45 DVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRPVRKKLKVKTVFNILGPMLNPACVPFAVVGVYNENLVLKMANALQRFGLKRALVVHSE-GLDEMSPLGPGLILDV-TQEKIERFSFDPLDYGIPRCTLESLQGGGPAYNAEVLRRVLSGE-RGXXXXXXXXXXXXXXXVSCKVNTLAEGVALAREIQLSGKALNTLDLWIEVSEG 686
            DVLE LGV I+LD EGV RC+ +AGIGFM + K+HPAM+F  PVR+++ ++TVFNILGP+ NPA   + V+GV +  L  K+ANAL R     ALVVH + G+DE++  GP LI +V     + +    P D G+ R   E+L+GG  AYN  ++R +LSGE RG                      LA GV +AR    SG+AL  L   I VS G
Sbjct:  122 DVLEGLGVQIELDAEGVARCLRDAGIGFMFAPKFHPAMRFAGPVRREIGIRTVFNILGPLTNPARARYQVLGVASAALAEKLANALSRLDTVHALVVHGDGGVDELTLSGPNLIFEVRAGHALRQMIVAPEDVGLERAPREALRGGDVAYNVALVRAILSGEDRGPRRDVVLLNAAAALVAGDVAPDLATGVKMARASIDSGRALERLHRMIAVSRG 338          
BLAST of DY258458 vs. ExPASy Swiss-Prot
Match: TRPD_DEHSC (Anthranilate phosphoribosyltransferase OS=Dehalococcoides sp. (strain CBDB1) GN=trpD PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 1.340e-39
Identity = 89/216 (41.20%), Postives = 139/216 (64.35%), Query Frame = 3
Query:   45 DVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRPVRKKLKVKTVFNILGPMLNPACVPFAVVGVYNENLVLKMANALQRFGLKRALVVHS-EGLDEMSPLGPGLILDVTQEKIERF--SFDPLDYGIPRCTLESLQGGGPAYNAEVLRRVLSGERGXXXXXXXXXXXXXXXVSCKVNTLAEGVALAREIQLSGKALNTLDLWIEVSE 683
            DVLEALG+ IDL+ E V+ C+++ GIGFM +  +HPAMKFV P R+++ ++TVFNILGP+ NPA   + ++GV    L  K+ +AL    +K ALVVH  +G+DEMS  G  +I ++  ++I +F  +  P + G+ + +L++++GG    NA  LR +LSG +G               V+ K++T+AEG++LA EI  +G ALN L+  I++S+
Sbjct:  121 DVLEALGIKIDLNAEQVKICIEQIGIGFMFAPVFHPAMKFVAPSRREIGIRTVFNILGPLTNPASAQYQLIGVPEIGLGDKIISALCHMDIKHALVVHGLDGMDEMSISGDSVIWELKDKEIIKFRHTVSPREMGLEQVSLQAVKGGAAEENALTLRAILSGAKGPKRDVVLLNAAAALMVADKIDTIAEGISLAAEIIDNGLALNKLESLIKLSQ 336          
BLAST of DY258458 vs. ExPASy Swiss-Prot
Match: TRPD_DEHE1 (Anthranilate phosphoribosyltransferase OS=Dehalococcoides ethenogenes (strain 195) GN=trpD PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 1.340e-39
Identity = 89/216 (41.20%), Postives = 139/216 (64.35%), Query Frame = 3
Query:   45 DVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRPVRKKLKVKTVFNILGPMLNPACVPFAVVGVYNENLVLKMANALQRFGLKRALVVHS-EGLDEMSPLGPGLILDVTQEKIERF--SFDPLDYGIPRCTLESLQGGGPAYNAEVLRRVLSGERGXXXXXXXXXXXXXXXVSCKVNTLAEGVALAREIQLSGKALNTLDLWIEVSE 683
            DVLEALG+ IDL+ E V+ C+++ GIGFM +  +HPAMKFV P R+++ ++TVFNILGP+ NPA   + ++GV    L  K+ +AL    +K ALVVH  +G+DEMS  G  +I ++  ++I +F  +  P + G+ + +L++++GG    NA  LR +LSG +G               V+ K++T+AEG++LA EI  +G ALN L+  I++S+
Sbjct:  121 DVLEALGIKIDLNAEQVKICIEQIGIGFMFAPVFHPAMKFVAPSRREIGIRTVFNILGPLTNPASAQYQLIGVPEIGLGDKIISALCHMDIKHALVVHGLDGMDEMSISGDSVIWELKDKEIIKFRHTVSPREMGLEQVSLQAVKGGAAEENALTLRAILSGAKGPKRDVVLLNAAAALMVADKIDTIAEGISLAAEIIDNGLALNKLESLIKLSQ 336          
BLAST of DY258458 vs. ExPASy Swiss-Prot
Match: TRPD_CHLFF (Anthranilate phosphoribosyltransferase OS=Chlamydophila felis (strain Fe/C-56) GN=trpD PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.985e-39
Identity = 79/214 (36.92%), Postives = 124/214 (57.94%), Query Frame = 3
Query:   45 DVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRPVRKKLKVKTVFNILGPMLNPACVPFAVVGVYNENLVLKMANALQRF-GLKRALVVHSEGLDEMSPLGPGLILDVTQEKIERFSFDPLDYGIPRCTLESLQGGGPAYNAEVLRRVLSGERGXXXXXXXXXXXXXXXVSCKVNTLAEGVALAREIQLSGKALNTLDLWIEVSE 683
            DVLEALG+ I++ PE +  C+ E GIGFM +  YHP++K + P+RK +K+ + FNILGP+LNPA   ++++GV NE ++  M+    +F   +R  + H  GLDE++ LG  +  D+ Q K  R   DP  +G   C +E L+GG    NA +L++  SG++G               +     TL EG+ +AR+  + G+AL  L+ W+  S+
Sbjct:  120 DVLEALGIEIEMTPEELLSCIQEVGIGFMFAPIYHPSLKKLAPIRKGMKIPSTFNILGPLLNPANTEYSLIGVSNEPILELMSEVCLQFQNTQRTFLFHGSGLDELTTLGKVVGYDIQQGKKTRIEIDPTSFGFASCKIEELKGGDSKMNAFILKKAFSGQQGAIADALIFNAGAAVWIFGNATTLEEGIQIARQTLMEGEALRVLEKWVAFSQ 333          
BLAST of DY258458 vs. ExPASy Swiss-Prot
Match: TRPD_AGRVS (Anthranilate phosphoribosyltransferase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=trpD PE=3 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 1.134e-38
Identity = 86/214 (40.19%), Postives = 122/214 (57.01%), Query Frame = 3
Query:   45 DVLEALGVVIDLDPEGVRRCVDEAGIGFMMSTKYHPAMKFVRPVRKKLKVKTVFNILGPMLNPACVPFAVVGVYNENLVLKMANALQRFGLKRALVVHSEGLDEMSPLGPGLILDVTQEKIERFSFDPLDYGIPRCTLESLQGGGPAYNAEVLRRVLSGERGXXXXXXXXXXXXXXXVSCKVNTLAEGVALAREIQLSGKALNTLDLWIEVSEG 686
            D L ALGV +D+DP  + RC+ EAG+GFM +  +H AM+ V P R +L  +T+FN+LGP+ NPA V   ++GVY    V+ +A  L+  G +   VVH  GLDE++  G   +  + Q KI  F   P D+G+ +  L +L+GG   YNA+ LR VL GE+                ++ K NTLA+G+AL  +   SG AL  L+  I VS G
Sbjct:  123 DSLTALGVKLDIDPSVIGRCISEAGVGFMFAQLHHSAMRHVGPARVELGTRTIFNLLGPLANPAGVKKQLLGVYAPEWVIPLAETLRDLGSESIWVVHGNGLDEITTTGTTQVAALEQGKIRSFELTPGDFGVAQVELAALKGGDGEYNAKALRAVLEGEKNAYRDVALCNAAAALVIAGKANTLADGMALGAQSLDSGAALKRLETLITVSNG 336          
The following BLAST results are available for this feature:
BLAST of DY258458 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
TRPD_ARATH6.351e-8272.17Anthranilate phosphoribosyltransferase, chloroplas... [more]
TRPD_CHLSY9.278e-4145.62Anthranilate phosphoribosyltransferase OS=Chlorofl... [more]
TRPD_CHLAA9.278e-4145.62Anthranilate phosphoribosyltransferase OS=Chlorofl... [more]
TRPD_RUBXD1.583e-4044.39Anthranilate phosphoribosyltransferase OS=Rubrobac... [more]
TRPD_RHILO6.014e-4040.19Anthranilate phosphoribosyltransferase OS=Rhizobiu... [more]
TRPD_CHLAD1.026e-3944.70Anthranilate phosphoribosyltransferase OS=Chlorofl... [more]
TRPD_DEHSC1.340e-3941.20Anthranilate phosphoribosyltransferase OS=Dehaloco... [more]
TRPD_DEHE11.340e-3941.20Anthranilate phosphoribosyltransferase OS=Dehaloco... [more]
TRPD_CHLFF2.985e-3936.92Anthranilate phosphoribosyltransferase OS=Chlamydo... [more]
TRPD_AGRVS1.134e-3840.19Anthranilate phosphoribosyltransferase OS=Agrobact... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAI1DE06FM2 AbsDev1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY258458 ID=DY258458; Name=DY258458; organism=Citrus clementina; type=EST; length=916bp
CTCAGCAAGGGAGTCGGTCTAGTTCTTCTGCATGTGGAAGTGCTGATGTG
TTAGAAGCTTTGGGTGTCGTTATTGACTTGGACCCAGAGGGTGTAAGAAG
GTGTGTGGATGAGGCAGGAATTGGTTTCATGATGTCGACAAAGTATCACC
CTGCAATGAAGTTTGTCAGGCCAGTGAGGAAAAAGCTCAAAGTAAAAACT
GTATTCAATATATTGGGTCCTATGTTGAATCCTGCATGTGTGCCATTCGC
TGTGGTTGGTGTTTACAATGAAAACTTGGTACTCAAAATGGCCAATGCAC
TGCAACGATTTGGCCTGAAAAGAGCATTGGTTGTTCACTCAGAGGGTTTG
GATGAGATGAGTCCCCTTGGACCTGGTCTGATCCTTGATGTCACCCAAGA
AAAAATTGAGAGATTCTCATTTGATCCATTGGACTACGGCATTCCTCGCT
GCACTTTAGAAAGCTTGCAAGGTGGAGGCCCAGCATATAATGCAGAGGTC
TTAAGGCGTGTACTGTCTGGAGAAAGAGGGGCAATAGCTGATGCATTAAT
CCTAAATGCTGCAGCAGCACTCTTGGTCAGTTGCAAAGTGAACACCTTGG
CTGAGGGTGTAGCCCTGGCGCGTGAAATTCAATTATCAGGGAAAGCTCTT
AATACGCTGGATTTATGGATAGAAGTCTCAGAGGGGGCGCCAGCATTTGC
TTGTGCATGAGTAATGGAGTTTTGAAGACTAAGAAAGACTTCATTGCAGT
ACCATGAATAACAGGTAGGTCAAAAGTTGGCTTGCTTATGCACGTCTCGT
CGATCAACTATTAGAAGAAAATTAAAGGTCCCTAAAATTATTATTGTTTT
ATTGAGTGTATCAAAAGTATTGGCTTATGGAATGGATTATGTTTATGTTG
AATACTTTTTTTGGGC
back to top