DY258462

Overview
NameDY258462
Unique NameDY258462
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length437
Libraries
Library NameType
AbsDev1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DY258462 vs. ExPASy Swiss-Prot
Match: FB302_ARATH (F-box protein At5g67140 OS=Arabidopsis thaliana GN=At5g67140 PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 1.597e-22
Identity = 50/69 (72.46%), Postives = 56/69 (81.16%), Query Frame = 3
Query:    3 ANSCPQLKSIVLWSCRQVTGNGLLFLVNKCGRLESINVWGTRLPLDCFIGLLTISPALQIKPEGLLLNA 209
            A  C QLK+I +W CR VT  GLL LVNKC +LESIN+WGTR+P+DCFI LLTISPALQIKP  LLLNA
Sbjct:  150 AERCHQLKTIGMWCCRHVTERGLLVLVNKCRKLESINLWGTRVPVDCFIALLTISPALQIKPMELLLNA 218          
The following BLAST results are available for this feature:
BLAST of DY258462 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
FB302_ARATH1.597e-2272.46F-box protein At5g67140 OS=Arabidopsis thaliana GN... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAI1DF01FM2 AbsDev1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY258462 ID=DY258462; Name=DY258462; organism=Citrus clementina; type=EST; length=437bp
TTGCAAATAGCTGTCCACAACTAAAGAGTATCGTCCTGTGGAGCTGCCGT
CAGGTTACAGGGAATGGGCTTCTTTTCCTAGTAAATAAATGTGGCAGACT
TGAGTCTATCAATGTATGGGGAACCAGACTTCCTTTAGACTGCTTCATTG
GCTTGCTTACAATTAGTCCTGCTCTTCAGATAAAGCCTGAAGGACTGCTC
TTAAATGCTGGAGTTGCGTCTATGTTGCCTGTTGCATAAGGTGCCAATTC
ATGGTTGCCTTTCTTTTGCTCTTTGTAGAGGTTATTTGTTTCCCTTTGTA
TTTTCATATTCATAATAAAATTTGTAATCTTGATGAAAGAAACCTATTGT
TTCAACTCTGGCTTGTACAGTGGCAAAGCAATTGTATTCTTTTGTGCAAA
TGTATCAAGATAGAAGAATAAATTTGTATGTGGATAT
back to top