DY258467

Overview
NameDY258467
Unique NameDY258467
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length932
Libraries
Library NameType
AbsDev1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DY258467 vs. ExPASy Swiss-Prot
Match: FKBP6_ARATH (FKBP-type peptidyl-prolyl cis-trans isomerase 6, chloroplastic OS=Arabidopsis thaliana GN=At3g60370 PE=1 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 1.595e-88
Identity = 164/224 (73.21%), Postives = 189/224 (84.38%), Query Frame = 1
Query:  100 QKKHTVRCSSSHNLKDNGFHCKVKLKRRVVPFLLFSSG--LFPTLSASGKTKSKNPYDEKRLLEQNKRMQKENSAPEGFPNFIREGFEVKVVTSENYIKRDSGLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELGPPVGPSTFFSAXQFEVFDVELLSVQDCQRRT-IGFYSDVVCN 762
            +   +V CS S   KD    C   L RR + ++L +S   L P LS+S KTKSK+PYDE+RLLEQNKR+Q+EN+AP+ FPNF+REGFEVKV+ S+NYIK DSGLIYRDF VG+GD PKDGQQV FHYIGYNESGRRIDSTY+QGSPARIRMGTNALVPGFE GIRDM+PGG+RRIIIPPELGPPVGPSTFFS+ QFEVFDVELLS+Q+C+RRT IGFYSDV C+
Sbjct:   25 RSNRSVCCSLSEEPKDQ---C---LSRRSLVYVLVASPCLLLPALSSSAKTKSKSPYDERRLLEQNKRIQRENNAPDEFPNFVREGFEVKVLASDNYIKADSGLIYRDFNVGQGDFPKDGQQVTFHYIGYNESGRRIDSTYIQGSPARIRMGTNALVPGFEMGIRDMKPGGRRRIIIPPELGPPVGPSTFFSSKQFEVFDVELLSIQNCERRTIIGFYSDVTCS 242          
BLAST of DY258467 vs. ExPASy Swiss-Prot
Match: FKBA_ECOLI (FKBP-type peptidyl-prolyl cis-trans isomerase fkpA OS=Escherichia coli (strain K12) GN=fkpA PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 4.012e-15
Identity = 50/147 (34.01%), Postives = 81/147 (55.10%), Query Frame = 1
Query:  295 RMQKENSAPEGFPNFIREGFEVKVVTSENYIKRDS-GLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELG------PPVGPSTFFSAXQFEVFDVELLSVQ 714
            +M+K+ +  E      RE F       E  +K  S GL+Y+  E GKG+ PKD   V+ +Y G    G+  D++Y +G P   R+  + ++PG+ EG+++++ GGK +++IPPEL       P + P++        VFDVELL V+
Sbjct:  116 KMEKDAADNEAKGKEYREKF-----AKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRL--DGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTL------VFDVELLDVK 249          
BLAST of DY258467 vs. ExPASy Swiss-Prot
Match: FKBA_ECOL6 (FKBP-type peptidyl-prolyl cis-trans isomerase fkpA OS=Escherichia coli O6 GN=fkpA PE=3 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 4.012e-15
Identity = 50/147 (34.01%), Postives = 81/147 (55.10%), Query Frame = 1
Query:  295 RMQKENSAPEGFPNFIREGFEVKVVTSENYIKRDS-GLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELG------PPVGPSTFFSAXQFEVFDVELLSVQ 714
            +M+K+ +  E      RE F       E  +K  S GL+Y+  E GKG+ PKD   V+ +Y G    G+  D++Y +G P   R+  + ++PG+ EG+++++ GGK +++IPPEL       P + P++        VFDVELL V+
Sbjct:  116 KMEKDAADNEAKGKEYREKF-----AKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRL--DGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTL------VFDVELLDVK 249          
BLAST of DY258467 vs. ExPASy Swiss-Prot
Match: FKBA_ECO57 (FKBP-type peptidyl-prolyl cis-trans isomerase fkpA OS=Escherichia coli O157:H7 GN=fkpA PE=3 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 4.012e-15
Identity = 50/147 (34.01%), Postives = 81/147 (55.10%), Query Frame = 1
Query:  295 RMQKENSAPEGFPNFIREGFEVKVVTSENYIKRDS-GLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELG------PPVGPSTFFSAXQFEVFDVELLSVQ 714
            +M+K+ +  E      RE F       E  +K  S GL+Y+  E GKG+ PKD   V+ +Y G    G+  D++Y +G P   R+  + ++PG+ EG+++++ GGK +++IPPEL       P + P++        VFDVELL V+
Sbjct:  116 KMEKDAADNEAKGKEYREKF-----AKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRL--DGVIPGWTEGLKNIKKGGKIKLVIPPELAYGKAGVPGIPPNSTL------VFDVELLDVK 249          
BLAST of DY258467 vs. ExPASy Swiss-Prot
Match: FKBP2_ARATH (Probable FKBP-type peptidyl-prolyl cis-trans isomerase 2, chloroplastic OS=Arabidopsis thaliana GN=At2g43560 PE=1 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 4.905e-13
Identity = 54/167 (32.34%), Postives = 78/167 (46.71%), Query Frame = 1
Query:  160 CKVK---LKRRVVPFLLFSSGLFPTLSASGKTKSKNPYDEKRLLEQNKRMQKENSAPEGFPNFIREGFEVKVVTSENYIKRDSGLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELGPPVG 651
            CK+     +R  +  +L  SG     S +       P D+ RL E     + EN               V +VT+E      SGL Y+D +VG+G  P  G QV  +Y+    SG+  DS+  +G P   R+G+  ++ G +EGI  M+ GGKRR+ IP  L  P G
Sbjct:   45 CKISNLSSRREAMLLVLGVSGGLSMSSLAAYAAGLPPEDKPRLCEAECEKELEN---------------VPMVTTE------SGLQYKDIKVGRGPSPPVGFQVAANYVAMVPSGQIFDSSLEKGLPYLFRVGSGQVIKGLDEGILSMKAGGKRRLYIPGPLAFPKG 190          
BLAST of DY258467 vs. ExPASy Swiss-Prot
Match: FKBA_BUCAI (FKBP-type peptidyl-prolyl cis-trans isomerase fkpA OS=Buchnera aphidicola subsp. Acyrthosiphon pisum GN=fkpA PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 2.061e-11
Identity = 45/149 (30.20%), Postives = 77/149 (51.68%), Query Frame = 1
Query:  268 EKRLLEQNKRMQKENSAPEGFPNFIREGFEVKVVTSENYIKR-DSGLIYRDFEVGKGDCPKDGQQVIFHYIGYNESGRRIDSTYLQGSPARIRMGTNALVPGFEEGIRDMRPGGKRRIIIPPELGPPVGPSTFFSAXQFEVFDVELLSV 711
            EK+L    K   K+N+      NFI+    +K  +    +K+  SGL+Y     G+G+  KD  ++  HY G   +G   D++Y +G P  +R+    ++ G++EG++ ++ GGK +++IPP L           A    +FD+ELL V
Sbjct:   95 EKKLKHATKIQLKKNAKE----NFIQGELYMKNFSKLKGVKKTSSGLLYLLERAGEGEALKDETKITVHYKGTLINGLEFDNSYKRGRPVSLRL--KDVILGWKEGLKYIKKGGKIKLVIPPNLAYGTEEVNGIPANSTLIFDIELLDV 237          
The following BLAST results are available for this feature:
BLAST of DY258467 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
FKBP6_ARATH1.595e-8873.21FKBP-type peptidyl-prolyl cis-trans isomerase 6, c... [more]
FKBA_ECOLI4.012e-1534.01FKBP-type peptidyl-prolyl cis-trans isomerase fkpA... [more]
FKBA_ECOL64.012e-1534.01FKBP-type peptidyl-prolyl cis-trans isomerase fkpA... [more]
FKBA_ECO574.012e-1534.01FKBP-type peptidyl-prolyl cis-trans isomerase fkpA... [more]
FKBP2_ARATH4.905e-1332.34Probable FKBP-type peptidyl-prolyl cis-trans isome... [more]
FKBA_BUCAI2.061e-1130.20FKBP-type peptidyl-prolyl cis-trans isomerase fkpA... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAI1DF10FM2 AbsDev1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY258467 ID=DY258467; Name=DY258467; organism=Citrus clementina; type=EST; length=932bp
ATGCAGATGATTTTGTCGTCATCTTCTTCTTCTCTACCTATCCCTTCGTT
TCCTTGTAAATGCTTTTCGACATTTCACGCTTTACGAACTTTCTTTCCTC
AAAAGAAGCATACAGTGCGTTGCAGCTCAAGTCACAACTTGAAAGATAAT
GGATTCCATTGCAAGGTAAAATTGAAGCGGAGGGTTGTCCCTTTCCTTTT
GTTCTCATCTGGCTTGTTCCCAACTTTATCTGCTTCTGGAAAGACGAAGA
GTAAGAACCCGTATGATGAAAAACGCTTGTTAGAACAAAACAAACGGATG
CAGAAAGAAAATAGTGCGCCAGAAGGTTTTCCAAATTTTATTAGAGAAGG
TTTTGAAGTTAAGGTAGTAACATCAGAGAATTACATAAAGCGTGACTCGG
GGCTTATATACCGGGATTTTGAAGTTGGTAAAGGTGATTGCCCAAAGGAT
GGTCAGCAGGTAATTTTCCACTATATTGGCTATAATGAGTCGGGCAGACG
GATTGACAGCACCTACTTACAGGGTTCTCCTGCCAGAATTCGTATGGGCA
CTAATGCATTAGTTCCAGGATTTGAGGAAGGAATTCGAGACATGAGACCA
GGAGGAAAAAGGAGGATAATCATTCCTCCAGAACTTGGACCACCAGTAGG
GCCTTCTACATTTTTCAGCGCANAACAGTTTGAAGTGTTCGATGTGGAGC
TGCTAAGCGTTCAGGATTGTCAAAGGAGGACCATTGGCTTTTACTCTGAT
GTCGTGTGTAATTGATGGGGCTAATTCCTAATATTTCTTGTCTTTGATTT
GCCTTCTCACTTCTGGAAATGTATCAGAGCTCCAATGAAAATTCATGTTT
GCTATTTAAGCATTAGATTAACGGAAAAGTCCTCTATGTCGTTTCCGTGG
CAAAAAAAAAAAAAAAAAAACCCCATTTTCTG
back to top