DY258482

Overview
NameDY258482
Unique NameDY258482
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1285
Libraries
Library NameType
AbsDev1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DY258482 vs. ExPASy Swiss-Prot
Match: CAPP1_SOYBN (Phosphoenolpyruvate carboxylase, housekeeping isozyme OS=Glycine max GN=PPC16 PE=2 SV=1)

HSP 1 Score: 512.686 bits (1319), Expect = 1.893e-144
Identity = 270/375 (72.00%), Postives = 289/375 (77.07%), Query Frame = 2
Query:    2 FLEPLELCYRSLCSCGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVIDAITKHLEIGSYREWSEEKRQEWLLSELSGKRPLFGPDLPKTEEIADVLETFHVIAELPADNFGAYIISMATAPSDVLAVELLQRECHVKQPLRVVPLFEKXXXXXXXXXXXXXXFSVDWYRNRINGKQEVMIGYSDSGKDAGRFSAAWQLYKAQEELIKVAKQYGIKLTMFHXXXXXXXXXXXPTHLAILSQPPDTIHGSLRVTVSGEVIEQSLGEEHLCFRTPSTFSRCHTLSMVCVPQFPPNPEWARMMEEKGIYCYKGKPLPWSSKNPDFVNISQWPTPKLEFGAFEFWKPPPPNQKPRGGI*ILFRGIPPGFFPW 1126
            FLEPLELCYRSLC+CGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDV+DAITKHLEIGSY+EWSEEKRQ+WLLSELSGKRPLFGPDLP+TEEI DVLETFHVIAELP DNFGAYIISMATAPSDVLAVELLQRECHVK PLRVVPLFEK              FSVDWYRNRINGKQEVMIGYSDSGKDAGRFSAAWQLYKAQEELI VAKQYG+KLTMFH           PTHLAILSQPP+TIHGSLRVTV GEVIEQS GE+HLCFRT   F+   TL     P   P PEW  +M+E  +   + +      K P FV   +  TP+LE+G        P  ++P GGI  L R I P  F W
Sbjct:  408 FLEPLELCYRSLCACGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITKHLEIGSYQEWSEEKRQQWLLSELSGKRPLFGPDLPQTEEIRDVLETFHVIAELPLDNFGAYIISMATAPSDVLAVELLQRECHVKHPLRVVPLFEKLADLEAAPAALARLFSVDWYRNRINGKQEVMIGYSDSGKDAGRFSAAWQLYKAQEELIMVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPETIHGSLRVTVQGEVIEQSFGEQHLCFRTLQRFTAA-TLEHGMHPPISPKPEWRALMDEMAVIATE-EYRSIVFKEPRFVEYFRLATPELEYGRMNIGS-RPAKRRPSGGIETL-RAI-PWIFAW 777          
BLAST of DY258482 vs. ExPASy Swiss-Prot
Match: CAPP_PHAVU (Phosphoenolpyruvate carboxylase OS=Phaseolus vulgaris PE=2 SV=1)

HSP 1 Score: 506.523 bits (1303), Expect = 1.357e-142
Identity = 265/375 (70.67%), Postives = 289/375 (77.07%), Query Frame = 2
Query:    2 FLEPLELCYRSLCSCGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVIDAITKHLEIGSYREWSEEKRQEWLLSELSGKRPLFGPDLPKTEEIADVLETFHVIAELPADNFGAYIISMATAPSDVLAVELLQRECHVKQPLRVVPLFEKXXXXXXXXXXXXXXFSVDWYRNRINGKQEVMIGYSDSGKDAGRFSAAWQLYKAQEELIKVAKQYGIKLTMFHXXXXXXXXXXXPTHLAILSQPPDTIHGSLRVTVSGEVIEQSLGEEHLCFRTPSTFSRCHTLSMVCVPQFPPNPEWARMMEEKGIYCYKGKPLPWSSKNPDFVNISQWPTPKLEFGAFEFWKPPPPNQKPRGGI*ILFRGIPPGFFPW 1126
            FL+PLELCYRSLC+CGDRAIADGSLLDFLRQVSTFGLS+VRLDIRQESDRHTDV+DAITKHLEIGSY+EWSEEKRQEWLLSELSGKRPLFGPDLP+TEEI DVL+TFHVIAELP DNFGAYIISMATAPSDVLAVELLQRECHVK PLRVVPLFEK              FSVDWY+NRI+GKQEVMIGYSDSGKDAGRFSAAWQLYKAQEEL+KVAK++GIKLTMFH           PTHLAILSQPPDTIHGSLRVTV GEVIEQ  GE+HLCFRT   F+   TL     P   P PEW  MM++  +   + +      K P FV   +  TP+LE+G        P  ++P GGI  L R I P  F W
Sbjct:  408 FLQPLELCYRSLCACGDRAIADGSLLDFLRQVSTFGLSIVRLDIRQESDRHTDVLDAITKHLEIGSYQEWSEEKRQEWLLSELSGKRPLFGPDLPQTEEIRDVLDTFHVIAELPPDNFGAYIISMATAPSDVLAVELLQRECHVKHPLRVVPLFEKLADLEAAPAALARLFSVDWYKNRIDGKQEVMIGYSDSGKDAGRFSAAWQLYKAQEELVKVAKKFGIKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHGSLRVTVQGEVIEQCFGEQHLCFRTLQRFTAA-TLEHGMNPPISPKPEWRAMMDQMAVIATE-EYRSIVFKEPRFVEYFRLATPELEYGRMNIGS-RPAKRRPSGGIETL-RAI-PWIFAW 777          
BLAST of DY258482 vs. ExPASy Swiss-Prot
Match: CAPP_TOBAC (Phosphoenolpyruvate carboxylase OS=Nicotiana tabacum GN=PPC PE=2 SV=1)

HSP 1 Score: 506.138 bits (1302), Expect = 1.772e-142
Identity = 267/375 (71.20%), Postives = 287/375 (76.53%), Query Frame = 2
Query:    2 FLEPLELCYRSLCSCGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVIDAITKHLEIGSYREWSEEKRQEWLLSELSGKRPLFGPDLPKTEEIADVLETFHVIAELPADNFGAYIISMATAPSDVLAVELLQRECHVKQPLRVVPLFEKXXXXXXXXXXXXXXFSVDWYRNRINGKQEVMIGYSDSGKDAGRFSAAWQLYKAQEELIKVAKQYGIKLTMFHXXXXXXXXXXXPTHLAILSQPPDTIHGSLRVTVSGEVIEQSLGEEHLCFRTPSTFSRCHTLSMVCVPQFPPNPEWARMMEEKGIYCYKGKPLPWSSKNPDFVNISQWPTPKLEFGAFEFWKPPPPNQKPRGGI*ILFRGIPPGFFPW 1126
            FLEPLELCYRSLC CGDR IADGSLLDFLRQVSTFGLS VRLDIRQESDRHTDV+DAIT+HLEIGSYREWSEE+RQEWLLSELSGKRPLFGPDLP+TEEIADVL+T HVIAELP+D FGAYIISMATAPSDVLAVELLQRECHVKQPLRVVPLFEK              FS++WYRNRINGKQEVM+GYSDSGKDAGRFSAAWQLYKAQEELIKVAK++G+KLTMFH           PTHLAILSQPPDTI GSLRVTV GEVIEQS GEEHLCFRT   F+   TL     P   P PEW  +M+E  +   + K      K P FV  S   TP+LE+G        P  +KP GGI  L R I P  F W
Sbjct:  406 FLEPLELCYRSLCECGDRPIADGSLLDFLRQVSTFGLSFVRLDIRQESDRHTDVLDAITQHLEIGSYREWSEERRQEWLLSELSGKRPLFGPDLPRTEEIADVLDTLHVIAELPSDCFGAYIISMATAPSDVLAVELLQRECHVKQPLRVVPLFEKLDDLESASAAVARLFSIEWYRNRINGKQEVMVGYSDSGKDAGRFSAAWQLYKAQEELIKVAKEHGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIQGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAA-TLEHGMHPPVSPKPEWRALMDEIAVIATE-KYRSIVFKEPRFVEYSALATPELEYGRMNIGS-RPSKRKPSGGIESL-RAI-PWIFAW 775          
BLAST of DY258482 vs. ExPASy Swiss-Prot
Match: CAPP2_SOYBN (Phosphoenolpyruvate carboxylase OS=Glycine max GN=PPC1 PE=2 SV=1)

HSP 1 Score: 505.753 bits (1301), Expect = 2.315e-142
Identity = 264/375 (70.40%), Postives = 288/375 (76.80%), Query Frame = 2
Query:    2 FLEPLELCYRSLCSCGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVIDAITKHLEIGSYREWSEEKRQEWLLSELSGKRPLFGPDLPKTEEIADVLETFHVIAELPADNFGAYIISMATAPSDVLAVELLQRECHVKQPLRVVPLFEKXXXXXXXXXXXXXXFSVDWYRNRINGKQEVMIGYSDSGKDAGRFSAAWQLYKAQEELIKVAKQYGIKLTMFHXXXXXXXXXXXPTHLAILSQPPDTIHGSLRVTVSGEVIEQSLGEEHLCFRTPSTFSRCHTLSMVCVPQFPPNPEWARMMEEKGIYCYKGKPLPWSSKNPDFVNISQWPTPKLEFGAFEFWKPPPPNQKPRGGI*ILFRGIPPGFFPW 1126
            FLE LELCYRSLC+CGDRAIADGSLLDF+RQVSTFGLSLVRLDIRQESDRHTDV+DAITKHLEIGSY+EWSEEKRQEWLLSELSGKRPLFGPDLP+TEEI DVL+TFHVIAELP DNFGAYIISMATAPSDVLAVELLQRECH+K PLRVVPLFEK              FS+DWYRNRINGKQEVMIGYSDSGKDAGRFSAAWQLYKAQEELI VAK++G+KLTMFH           PTHLAILSQPPDTIHGSLRVTV GEVIEQS GE+HLCFRT   F+   TL     P   P PEW  +M++  +   + +      K P FV   +  TP+LE+G        P  ++P GGI  L R I P  F W
Sbjct:  408 FLESLELCYRSLCACGDRAIADGSLLDFMRQVSTFGLSLVRLDIRQESDRHTDVLDAITKHLEIGSYQEWSEEKRQEWLLSELSGKRPLFGPDLPQTEEIRDVLDTFHVIAELPPDNFGAYIISMATAPSDVLAVELLQRECHIKHPLRVVPLFEKLADLEAAPAALARLFSIDWYRNRINGKQEVMIGYSDSGKDAGRFSAAWQLYKAQEELINVAKKFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHGSLRVTVQGEVIEQSFGEQHLCFRTLQRFTAA-TLEHGMHPPISPKPEWRALMDQMAVIATE-EYRSIVFKEPRFVEYFRLATPELEYGRMNIGS-RPAKRRPSGGIETL-RAI-PWIFAW 777          
BLAST of DY258482 vs. ExPASy Swiss-Prot
Match: CAPP1_ARATH (Phosphoenolpyruvate carboxylase 1 OS=Arabidopsis thaliana GN=PPC1 PE=1 SV=1)

HSP 1 Score: 503.827 bits (1296), Expect = 8.796e-142
Identity = 267/378 (70.63%), Postives = 288/378 (76.19%), Query Frame = 2
Query:    2 FLEPLELCYRSLCSCGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVIDAITKHLEIGSYREWSEEKRQEWLLSELSGKRPLFGPDLPKTEEIADVLETFHVIAELPADNFGAYIISMATAPSDVLAVELLQRECHVKQPLRVVPLFEKXXXXXXXXXXXXXXFSVDWYRNRINGKQEVMIGYSDSGKDAGRFSAAWQLYKAQEELIKVAKQYGIKLTMFHXXXXXXXXXXXPTHLAILSQPPDTIHGSLRVTVSGEVIEQSLGEEHLCFRTPSTFSRCHTLSMVCVPQFPPNPEWARMMEEKGIYC---YKGKPLPWSSKNPDFVNISQWPTPKLEFGAFEFWKPPPPNQKPRGGI*ILFRGIPPGFFPW 1126
            FLEPLELCYRSLCSCGDR IADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDV+DAIT HL+IGSYREWSEE+RQEWLLSELSGKRPLFG DLPKTEEIADVL+TFHVIAELPAD+FGAYIISMATAPSDVLAVELLQREC VKQPLRVVPLFEK              FSVDWY+NRINGKQEVMIGYSDSGKDAGR SAAWQLYKAQEEL+KVAK+YG+KLTMFH           PTHLAILSQPPDTI+GSLRVTV GEVIEQS GEEHLCFRT   F+   TL     P   P PEW  +++E  +     Y+        + P FV   +  TP+LE+G        P  +KP GGI  L R I P  F W
Sbjct:  408 FLEPLELCYRSLCSCGDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITTHLDIGSYREWSEERRQEWLLSELSGKRPLFGSDLPKTEEIADVLDTFHVIAELPADSFGAYIISMATAPSDVLAVELLQRECRVKQPLRVVPLFEKLADLEAAPAAVARLFSVDWYKNRINGKQEVMIGYSDSGKDAGRLSAAWQLYKAQEELVKVAKEYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTINGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAA-TLEHGMRPPISPKPEWRALLDEMAVVATEEYRSVVF----QEPRFVEYFRLATPELEYGRMNIGS-RPSKRKPSGGIESL-RAI-PWIFAW 777          
BLAST of DY258482 vs. ExPASy Swiss-Prot
Match: CAPP_PEA (Phosphoenolpyruvate carboxylase OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 498.434 bits (1282), Expect = 3.695e-140
Identity = 262/375 (69.87%), Postives = 286/375 (76.27%), Query Frame = 2
Query:    2 FLEPLELCYRSLCSCGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVIDAITKHLEIGSYREWSEEKRQEWLLSELSGKRPLFGPDLPKTEEIADVLETFHVIAELPADNFGAYIISMATAPSDVLAVELLQRECHVKQPLRVVPLFEKXXXXXXXXXXXXXXFSVDWYRNRINGKQEVMIGYSDSGKDAGRFSAAWQLYKAQEELIKVAKQYGIKLTMFHXXXXXXXXXXXPTHLAILSQPPDTIHGSLRVTVSGEVIEQSLGEEHLCFRTPSTFSRCHTLSMVCVPQFPPNPEWARMMEEKGIYCYKGKPLPWSSKNPDFVNISQWPTPKLEFGAFEFWKPPPPNQKPRGGI*ILFRGIPPGFFPW 1126
            FLEPLELCYRSLC CGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDV+DAITKHLEIGSY+EWSEEKRQEWLLSEL GKRPLFGPDLP T+EI DVL+TFHVIAELP+DNFGAYIISMATAPSDVLAVELLQREC +K PLRVVPLFEK              FS+DWYRNRI+GKQEVMIGYSDSGKDAGRFSAAWQLYKAQEELI VA+++ +KLTMFH           PTHLAILSQPPDTIHGSLRVTV GEVIEQS GEEHLCFRT   F+   TL     P   P PEW  +M++  I   + +      K P FV   +  TP++E+G        P  ++P GGI  L R I P  FPW
Sbjct:  407 FLEPLELCYRSLCFCGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVMDAITKHLEIGSYQEWSEEKRQEWLLSELVGKRPLFGPDLPTTDEIRDVLDTFHVIAELPSDNFGAYIISMATAPSDVLAVELLQRECKIKNPLRVVPLFEKLADLEAAPAALARLFSIDWYRNRIDGKQEVMIGYSDSGKDAGRFSAAWQLYKAQEELINVAQKFSVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAA-TLEHGMRPPSSPKPEWRALMDQMAIIATE-EYRSIVFKEPRFVEYFRLATPEMEYGRMNIGS-RPAKRRPSGGIETL-RAI-PWIFPW 776          
BLAST of DY258482 vs. ExPASy Swiss-Prot
Match: CAPP_SOLTU (Phosphoenolpyruvate carboxylase OS=Solanum tuberosum GN=PPC1 PE=2 SV=2)

HSP 1 Score: 497.664 bits (1280), Expect = 6.303e-140
Identity = 263/375 (70.13%), Postives = 287/375 (76.53%), Query Frame = 2
Query:    2 FLEPLELCYRSLCSCGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVIDAITKHLEIGSYREWSEEKRQEWLLSELSGKRPLFGPDLPKTEEIADVLETFHVIAELPADNFGAYIISMATAPSDVLAVELLQRECHVKQPLRVVPLFEKXXXXXXXXXXXXXXFSVDWYRNRINGKQEVMIGYSDSGKDAGRFSAAWQLYKAQEELIKVAKQYGIKLTMFHXXXXXXXXXXXPTHLAILSQPPDTIHGSLRVTVSGEVIEQSLGEEHLCFRTPSTFSRCHTLSMVCVPQFPPNPEWARMMEEKGIYCYKGKPLPWSSKNPDFVNISQWPTPKLEFGAFEFWKPPPPNQKPRGGI*ILFRGIPPGFFPW 1126
            FLEPLELCYRSLC+CGD +IADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDV+DAIT+HLEIGSYR+WSEE+RQEWLLSELSGKRPLFGPDLPKTEEIADVL+TFHVIAELPAD FGAYIISMATAPSDVLAVELLQREC V+QPLRVVPLFEK              FS++WYRNRINGKQEVMIGYSDSGKDAGR SAAWQLYKAQEELI+VAK++ +KLTMFH           P HLAILSQPP+TIHGSLRVTV GEVIEQS GEEHLCFRT   F+   TL     P   P PEW  +M+E  +   + K      K P FV   +  TP+LE+G        P  +KP GGI  L R I P  F W
Sbjct:  407 FLEPLELCYRSLCACGDLSIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITQHLEIGSYRDWSEERRQEWLLSELSGKRPLFGPDLPKTEEIADVLDTFHVIAELPADCFGAYIISMATAPSDVLAVELLQRECRVRQPLRVVPLFEKLADLDAAPAAVARLFSIEWYRNRINGKQEVMIGYSDSGKDAGRLSAAWQLYKAQEELIQVAKEFDVKLTMFHGRGGTVGRGGGPAHLAILSQPPETIHGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAA-TLEHGMHPPVSPKPEWRALMDEIAVVATE-KYRSIVFKEPRFVEYFRLATPELEYGRMNIGS-RPSKRKPSGGIESL-RAI-PWIFAW 776          
BLAST of DY258482 vs. ExPASy Swiss-Prot
Match: CAPP1_SACHY (Phosphoenolpyruvate carboxylase, housekeeping isozyme OS=Saccharum hybrid PE=3 SV=1)

HSP 1 Score: 496.123 bits (1276), Expect = 1.834e-139
Identity = 259/375 (69.07%), Postives = 289/375 (77.07%), Query Frame = 2
Query:    2 FLEPLELCYRSLCSCGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVIDAITKHLEIGSYREWSEEKRQEWLLSELSGKRPLFGPDLPKTEEIADVLETFHVIAELPADNFGAYIISMATAPSDVLAVELLQRECHVKQPLRVVPLFEKXXXXXXXXXXXXXXFSVDWYRNRINGKQEVMIGYSDSGKDAGRFSAAWQLYKAQEELIKVAKQYGIKLTMFHXXXXXXXXXXXPTHLAILSQPPDTIHGSLRVTVSGEVIEQSLGEEHLCFRTPSTFSRCHTLSMVCVPQFPPNPEWARMMEEKGIYCYKGKPLPWSSKNPDFVNISQWPTPKLEFGAFEFWKPPPPNQKPRGGI*ILFRGIPPGFFPW 1126
            FLEPLELCYRSLC+CGDR++ADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDV+DAIT++L IGSYR+W+EEKRQEWLLSEL+GKRPLFGPDLPK++EIADVL+TFHV+AELP+D+FGAY+ISMATAPSDVLAVELLQRECHVK+PLRVVPLFEK              FSV+WYRNRINGKQEVMIGYSDSGKDAGRFSAAWQLYKAQEELI VAK YG+KLTMFH           PTHLAILSQPP+TIHGSLRVTV GEVIEQS GEEHLCFRT   F+   TL     P   P PEW  +M+E  I   K +      + P FV   +  TP++E+G        P  +KP  GI  L R I P  F W
Sbjct:  407 FLEPLELCYRSLCACGDRSVADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVMDAITEYLGIGSYRKWTEEKRQEWLLSELNGKRPLFGPDLPKSDEIADVLDTFHVLAELPSDSFGAYVISMATAPSDVLAVELLQRECHVKKPLRVVPLFEKLADLEAAPAALARLFSVEWYRNRINGKQEVMIGYSDSGKDAGRFSAAWQLYKAQEELINVAKLYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPETIHGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAA-TLEHGMHPPISPKPEWRALMDEMAIVATK-EYRSIVFEEPRFVEYFRLATPEMEYGRMNIGS-RPSKRKPSAGIESL-RAI-PWIFAW 776          
BLAST of DY258482 vs. ExPASy Swiss-Prot
Match: CAPP1_FLAPR (Phosphoenolpyruvate carboxylase OS=Flaveria pringlei GN=PPCA1 PE=2 SV=1)

HSP 1 Score: 494.197 bits (1271), Expect = 6.969e-139
Identity = 258/375 (68.80%), Postives = 285/375 (76.00%), Query Frame = 2
Query:    2 FLEPLELCYRSLCSCGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVIDAITKHLEIGSYREWSEEKRQEWLLSELSGKRPLFGPDLPKTEEIADVLETFHVIAELPADNFGAYIISMATAPSDVLAVELLQRECHVKQPLRVVPLFEKXXXXXXXXXXXXXXFSVDWYRNRINGKQEVMIGYSDSGKDAGRFSAAWQLYKAQEELIKVAKQYGIKLTMFHXXXXXXXXXXXPTHLAILSQPPDTIHGSLRVTVSGEVIEQSLGEEHLCFRTPSTFSRCHTLSMVCVPQFPPNPEWARMMEEKGIYCYKGKPLPWSSKNPDFVNISQWPTPKLEFGAFEFWKPPPPNQKPRGGI*ILFRGIPPGFFPW 1126
            FLEPLELCYRSLC CGDR IADGSLLDFLRQVSTFGLSLV+LDIRQESDRHTDV+DAIT+HLEIGSYREWSEEKRQEWLL+ELSGKRPLFG DLPKTEE+ DVL+TF+V+AELP+D FGAYIISMAT+PSDVLAVELLQRECHVK PLRVVPLFEK              FS+DWYRNRI+GKQEVMIGYSDSGKDAGRFSAAWQLYKAQEE+IKVAK++G+KL +FH           PTHLAILSQPPDTIHGSLRVTV GEVIEQS GEEHLCFRT   F    TL     P   P PEW  +M++  +   + +      K P FV   +  TP+LE+G        P  +KP GGI  L R I P  F W
Sbjct:  407 FLEPLELCYRSLCDCGDRVIADGSLLDFLRQVSTFGLSLVKLDIRQESDRHTDVLDAITQHLEIGSYREWSEEKRQEWLLAELSGKRPLFGSDLPKTEEVKDVLDTFNVLAELPSDCFGAYIISMATSPSDVLAVELLQRECHVKHPLRVVPLFEKLADLEAAPAAMARLFSIDWYRNRIDGKQEVMIGYSDSGKDAGRFSAAWQLYKAQEEIIKVAKEFGVKLVIFHGRGGTVGRGGGPTHLAILSQPPDTIHGSLRVTVQGEVIEQSFGEEHLCFRTLQRFCAA-TLEHGMNPPISPRPEWRELMDQMAVVATE-EYRSIVFKEPRFVEYFRLATPELEYGRMNIGS-RPSKRKPSGGIESL-RAI-PWIFAW 776          
BLAST of DY258482 vs. ExPASy Swiss-Prot
Match: CAPP_MEDSA (Phosphoenolpyruvate carboxylase OS=Medicago sativa GN=PEPC PE=2 SV=1)

HSP 1 Score: 491.5 bits (1264), Expect = 4.517e-138
Identity = 258/375 (68.80%), Postives = 287/375 (76.53%), Query Frame = 2
Query:    2 FLEPLELCYRSLCSCGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVIDAITKHLEIGSYREWSEEKRQEWLLSELSGKRPLFGPDLPKTEEIADVLETFHVIAELPADNFGAYIISMATAPSDVLAVELLQRECHVKQPLRVVPLFEKXXXXXXXXXXXXXXFSVDWYRNRINGKQEVMIGYSDSGKDAGRFSAAWQLYKAQEELIKVAKQYGIKLTMFHXXXXXXXXXXXPTHLAILSQPPDTIHGSLRVTVSGEVIEQSLGEEHLCFRTPSTFSRCHTLSMVCVPQFPPNPEWARMMEEKGIYCYKGKPLPWSSKNPDFVNISQWPTPKLEFGAFEFWKPPPPNQKPRGGI*ILFRGIPPGFFPW 1126
            FLEPLELCYRSLC+CGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDV+DAITKHLEIGSY+EWSEEKRQEWLLSEL GKRPLFGPDLP+T+EI DVL+TF VIAELP+DNFGAYIISMATAPSDVLAVELLQREC V+ PLRVVPLFEK              FS+DWY NRI+GKQEVMIGYSDSGKDAGRFSAAWQLYKAQE+LIKVA+++G+KLTMFH           PTHLAILSQPP+TIHGSLRVTV GEVIEQS GEEHLCFRT   F+   TL     P   P PEW  +M++  +   + +      K P FV   +  TP++E+G        P  ++P GGI  L R I P  F W
Sbjct:  407 FLEPLELCYRSLCACGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVMDAITKHLEIGSYQEWSEEKRQEWLLSELIGKRPLFGPDLPQTDEIRDVLDTFRVIAELPSDNFGAYIISMATAPSDVLAVELLQRECKVRNPLRVVPLFEKLDDLESAPAALARLFSIDWYINRIDGKQEVMIGYSDSGKDAGRFSAAWQLYKAQEDLIKVAQKFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPETIHGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAA-TLEHGMRPPSSPKPEWRALMDQMAVIATE-EYRSIVFKEPRFVEYFRLATPEMEYGRMNIGS-RPAKRRPSGGIETL-RAI-PWIFAW 776          
The following BLAST results are available for this feature:
BLAST of DY258482 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 229
Match NameE-valueIdentityDescription
CAPP1_SOYBN1.893e-14472.00Phosphoenolpyruvate carboxylase, housekeeping isoz... [more]
CAPP_PHAVU1.357e-14270.67Phosphoenolpyruvate carboxylase OS=Phaseolus vulga... [more]
CAPP_TOBAC1.772e-14271.20Phosphoenolpyruvate carboxylase OS=Nicotiana tabac... [more]
CAPP2_SOYBN2.315e-14270.40Phosphoenolpyruvate carboxylase OS=Glycine max GN=... [more]
CAPP1_ARATH8.796e-14270.63Phosphoenolpyruvate carboxylase 1 OS=Arabidopsis t... [more]
CAPP_PEA3.695e-14069.87Phosphoenolpyruvate carboxylase OS=Pisum sativum P... [more]
CAPP_SOLTU6.303e-14070.13Phosphoenolpyruvate carboxylase OS=Solanum tuberos... [more]
CAPP1_SACHY1.834e-13969.07Phosphoenolpyruvate carboxylase, housekeeping isoz... [more]
CAPP1_FLAPR6.969e-13968.80Phosphoenolpyruvate carboxylase OS=Flaveria pringl... [more]
CAPP_MEDSA4.517e-13868.80Phosphoenolpyruvate carboxylase OS=Medicago sativa... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAI2AA03FM1 AbsDev1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY258482 ID=DY258482; Name=DY258482; organism=Citrus clementina; type=EST; length=1285bp
GTTCTTGGAACCTCTTGAACTCTGTTATAGGTCACTCTGCTCTTGCGGTG
ACCGAGCGATTGCTGATGGAAGCCTTCTCGATTTCTTGAGGCAAGTCTCC
ACCTTCGGACTCTCACTTGTCAGGCTTGATATCAGGCAAGAGTCTGATCG
TCATACTGATGTCATAGATGCCATCACCAAGCACCTGGAAATTGGTTCCT
ACCGAGAATGGTCTGAAGAAAAGAGGCAGGAATGGCTTTTATCTGAACTC
AGTGGCAAGCGTCCACTGTTTGGCCCTGACCTTCCTAAAACTGAAGAAAT
TGCTGATGTTTTGGAGACATTTCATGTCATAGCTGAACTTCCAGCTGATA
ATTTTGGAGCATACATCATATCGATGGCAACAGCACCATCTGATGTGCTG
GCTGTTGAACTCCTACAGCGTGAATGCCATGTGAAACAACCACTTAGAGT
TGTTCCACTTTTTGAGAAGCTTGCAGATTTGGAGGCAGCACCTGCTGCTC
TGGCCCGACTCTTTTCAGTCGATTGGTACAGGAATCGGATCAATGGTAAG
CAAGAAGTCATGATTGGGTACTCAGATTCTGGTAAAGATGCTGGGCGATT
CTCGGCTGCCTGGCAGTTATACAAGGCTCAAGAGGAGCTTATAAAGGTAG
CAAAGCAATATGGTATAAAACTAACCATGTTCCATGGTCGTGGTGGAACT
GTTGGAAGAGGAGGTGGTCCCACCCATCTTGCCATATTGTCTCAACCACC
AGATACAATTCATGGCTCACTGCGTGTTACTGTTTCAGGTGAAGTTATTG
AGCAATCATTGGGGGAGGAACACTTGTGCTTTAGAACACCTTCAACGTTT
TCCCGCTGCCACACCTTGAGCATGGTATGCGTCCCCCAATTTCCACCGAA
CCCAGAATGGGCCAGAATGATGGAAGAAAAGGGCATTTATTGCTACAAAG
GAAAACCGCTCCCTTGGTCTTCAAAAAACCCCGATTTTGTTAATATTTCT
CAATGGCCTACCCCAAAATTGGAATTTGGGGCTTTTGAATTTTGGAAACC
CCCCCCTCCCAACCAAAAGCCAAGGGGGGGGATTTAAATCCTCTTTCGGG
GCATCCCCCCGGGATTTTTTCCCTGGGACCACAAACCCAAAATTTTCCCC
TTCCCACGGGGGGGGTTTTGGTTTTTTGGGGGTGTTCTTTTTTTAAAAAC
GTTTTTTTTTTTCAAAAAGAAGAAAAATTTTAAGAGAATACCCCCCCCTC
CCGCTGGTTGGCGTGGGGAAGAGAAGAAAGGATAT
back to top